Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.86
PubTator Score 1.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 1.05377080203884E-5
gastric cancer 436 6.56827737691271E-4
medulloblastoma, large-cell 6234 0.00541215055412119
active Crohn's disease 918 0.0166345330462517
Disease Target Count Z-score Confidence
Focal epilepsy 5 3.002 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
gastric cancer 1.100 0.001
osteosarcoma -2.348 0.000
medulloblastoma, large-cell -1.100 0.005
active Crohn's disease 1.173 0.017

Synonym

Accession Q8N4J0 Q7Z383 Q8N7C5
Symbols C9orf41
UPF0586

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Xenopus OMA EggNOG
C. elegans OMA EggNOG
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

AA Sequence

MQRRRRPPPPTSRLPEGCGGGGGGSEEVEVQFSAGRWGSAAAVSAAAAAATRSTEEEEERLEREHFWKII      1 - 70
NAFRYYGTSMHERVNRTERQFRSLPANQQKLLPQFLLHLDKIRKCIDHNQEILLTIVNDCIHMFENKEYG     71 - 140
EDGNGKIMPASTFDMDKLKSTLKQFVRDWSETGKAERDACYQPIIKEILKNFPKERWDPSKVNILVPGAG    141 - 210
LGRLAWEIAMLGYACQGNEWSFFMLFSSNFVLNRCSEINKYKLYPWIHQFSNNRRSADQIRPIFFPDVDP    211 - 280
HSLPPGSNFSMTAGDFQEIYSECNTWDCIATCFFIDTAHNVIDYIDTIWKILKPGGIWINLGPLLYHFEN    281 - 350
LANELSIELSYEDIKNVVLQYGFKVEVEKESVLSTYTVNDLSMMKYYYECVLFVVRKPQ               351 - 409
//

Text Mined References (9)

PMID Year Title
26001783 2015 UPF0586 Protein C9orf41 Homolog Is Anserine-producing Methyltransferase.
21269460 2011 Initial characterization of the human central proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.