Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.53
PubTator Score 2.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 7.6e-05
chronic rhinosinusitis 512 2.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Hepatitis E 11 3.141 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
chronic rhinosinusitis 2.092 2.2e-02
osteosarcoma 1.096 7.6e-05

Gene RIF (2)

AA Sequence

MAWASRLGLLLALLLPVVGASTPGTVVRLNKAALSYVSEIGKAPLQRALQVTVPHFLDWSGEALQPTRIR      1 - 70
ILNVHVPRLHLKFIAGFGVRLLAAANFTFKVFRAPEPLELTLPVELLADTRVTQSSIRTPVVSISACSLF     71 - 140
SGHANEFDGSNSTSHALLVLVQKHIKAVLSNKLCLSISNLVQGVNVHLGTLIGLNPVGPESQIRYSMVSV    141 - 210
PTVTSDYISLEVNAVLFLLGKPIILPTDATPFVLPRHVGTEGSMATVGLSQQLFDSALLLLQKAGALNLD    211 - 280
ITGQLRSDDNLLNTSALGRLIPEVARQFPEPMPVVLKVRLGATPVAMLHTNNATLRLQPFVEVLATASNS    281 - 350
AFQSLFSLDVVVNLRLQLSVSKVKLQGTTSVLGDVQLTVASSNVGFIDTDQVRTLMGTVFEKPLLDHLNA    351 - 420
LLAMGIALPGVVNLHYVAPEIFVYEGYVVISSGLFYQS                                    421 - 458
//

Text Mined References (18)

PMID Year Title