Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.53
PubTator Score 2.68

Knowledge Summary


No data available


  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 7.6e-05
chronic rhinosinusitis 512 2.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Hepatitis E 11 3.141 1.6


  Differential Expression (2)

Disease log2 FC p
chronic rhinosinusitis 2.092 2.2e-02
osteosarcoma 1.096 7.6e-05


Accession Q8N4F0 Q6UWN3 Q6ZME0 Q8NFQ7
Symbols RYSR


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

LLAMGIALPGVVNLHYVAPEIFVYEGYVVISSGLFYQS                                    421 - 458

Text Mined References (18)

PMID Year Title