Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.41
PubTator Score 2.68

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 7.5659525389868E-5
chronic rhinosinusitis 512 0.0222002024254787
Disease Target Count Z-score Confidence
Hepatitis E 11 3.162 1.6
Common cold 63 3.028 1.5


  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.096 0.000
chronic rhinosinusitis 2.092 0.022


Accession Q8N4F0 Q6UWN3 Q6ZME0 Q8NFQ7
Symbols RYSR


  Ortholog (8)

Gene RIF (2)

20237496 Observational study of gene-disease association. (HuGE Navigator)
12185532 BPIL1 maps to Chromosome 20q11; thus, these novel genes form a cluster with BPI and two other members of the LT/LBP gene family on the long arm of human Chr 20. AA sequence is reported.

AA Sequence

LLAMGIALPGVVNLHYVAPEIFVYEGYVVISSGLFYQS                                    421 - 458

Text Mined References (18)

PMID Year Title
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
21787333 2011 Systematic nomenclature for the PLUNC/PSP/BSP30/SMGB proteins as a subfamily of the BPI fold-containing superfamily.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16740002 2006 Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14739326 2004 Phylogenetic and evolutionary analysis of the PLUNC gene family.