Property Summary

NCBI Gene PubMed Count 44
PubMed Score 80.90
PubTator Score 51.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma, Renal Cell 124 0.0 0.0
Paroxysmal nonkinesigenic dyskinesia 2 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0
Disease Target Count Z-score Confidence
Dystonia 164 5.373 2.7

Expression

  Differential Expression (17)

Disease log2 FC p
active Crohn's disease -1.200 5.0e-03
atypical teratoid / rhabdoid tumor -1.200 1.9e-04
Breast cancer 1.600 9.4e-08
breast carcinoma 1.200 2.9e-25
ductal carcinoma in situ 1.300 1.6e-02
ependymoma -1.400 2.0e-03
group 3 medulloblastoma -2.300 2.0e-05
intraductal papillary-mucinous neoplasm ... 2.000 3.4e-03
invasive ductal carcinoma 1.600 1.1e-02
medulloblastoma, large-cell -1.800 1.8e-04
oligodendroglioma -1.100 3.5e-02
osteosarcoma -1.138 7.4e-03
ovarian cancer 1.300 4.7e-04
pancreatic cancer 1.100 1.8e-05
pancreatic ductal adenocarcinoma liver m... -1.449 1.1e-02
Pick disease -1.300 7.9e-03
primitive neuroectodermal tumor -1.300 9.1e-04

Gene RIF (20)

AA Sequence

MAAVVAATALKGRGARNARVLRGILAGATANKASHNRTRALQSHSSPEGKEEPEPLSPELEYIPRKRGKN      1 - 70
PMKAVGLAWYSLYTRTWLGYLFYRQQLRRARNRYPKGHSKTQPRLFNGVKVLPIPVLSDNYSYLIIDTQA     71 - 140
QLAVAVDPSDPRAVQASIEKEGVTLVAILCTHKHWDHSGGNRDLSRRHRDCRVYGSPQDGIPYLTHPLCH    141 - 210
QDVVSVGRLQIRALATPGHTQGHLVYLLDGEPYKGPSCLFSGDLLFLSGCGRTFEGNAETMLSSLDTVLG    211 - 280
LGDDTLLWPGHEYAEENLGFAGVVEPENLARERKMQWVQRQRLERKGTCPSTLGEERSYNPFLRTHCLAL    281 - 350
QEALGPGPGPTGDDDYSRAQLLEELRRLKDMHKSK                                       351 - 385
//

Text Mined References (51)

PMID Year Title