Property Summary

NCBI Gene PubMed Count 26
Grant Count 22
R01 Count 18
Funding $1,866,962.57
PubMed Score 57.81
PubTator Score 27.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Multiple myeloma 1.408 0.020
astrocytic glioma -2.000 0.013
oligodendroglioma -1.500 0.036
psoriasis 1.600 0.000
osteosarcoma 2.156 0.000
posterior fossa group B ependymoma -1.600 0.000
glioblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
medulloblastoma, large-cell -1.100 0.004
juvenile dermatomyositis 1.006 0.000
acute quadriplegic myopathy 1.023 0.000
tuberculosis -1.600 0.000
primary pancreatic ductal adenocarcinoma 1.567 0.038
lung cancer -1.400 0.012
pediatric high grade glioma -1.500 0.000
group 4 medulloblastoma 1.300 0.000
pilocytic astrocytoma -1.400 0.000
spina bifida -1.725 0.036
Pick disease 1.200 0.001
ovarian cancer 1.400 0.001
pancreatic cancer 1.500 0.031
dermatomyositis 1.200 0.001

Gene RIF (10)

PMID Text
26104682 Results identify a novel YY1 ~ miR-9 ~ RYBP axis involved in melanoma tumorigenesis and reinforce the idea that regulatory circuitries involving miRNAs and TFs are prevalent mechanisms.
25344099 RYBP has a role in survival of patients with hepatocellular carcinoma (HCC) and responsiveness to chemotherapy
22723975 Polymorphisms in RYBP and AOAH genes are associated with chronic rhinosinusitis in a Chinese population.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19098711 RYBP interacts with MDM2 via residues 1-73 and 144-228 & decreases MDM2-mediated p53 ubiquitination, stabilizing p53 increasing its activity. RYBP is decreased in human cancer tissues.
18551146 Adenovirus expressing Rybp synergistically cooperates with the death receptor ligand, tumor necrosis factor-alpha, in the induction of apoptosis, and thus may have clinical applicability for the treatment of cancer.
14765135 DEDAF associates with a DED-containing DNA-binding protein in the nucleus and regulates the transcription activity [DEDAF human]
14691460 Apoptin is efficiently delivered and induced apoptosis in cancer cells when fused to the HIV-TAT protein transduction domain.
12411495 interacts specifically with the E2F2 and E2F3 family members, dependent on the marked box domain in these proteins
11953439 YEAF1/RYBP and YAF-2 are functionally distinct members of a cofactor family for the YY1 and E4TF1/hGABP transcription factors.

AA Sequence

MTMGDKKSPTRPKRQAKPAADEGFWDCSVCTFRNSAEAFKCSICDVRKGTSTRKPRINSQLVAQQVAQQY      1 - 70
ATPPPPKKEKKEKVEKQDKEKPEKDKEISPSVTKKNTNKKTKPKSDILKDPPSEANSIQSANATTKTSET     71 - 140
NHTSRPRLKNVDRSTAQQLAVTVGNVTVIITDFKEKTRSSSTSSSTVTSSAGSEQQNQSSSGSESTDKGS    141 - 210
SRSSTPKGDMSAVNDESF                                                        211 - 228
//

Text Mined References (33)

PMID Year Title
26687479 2015 The variant Polycomb Repressor Complex 1 component PCGF1 interacts with a pluripotency sub-network that includes DPPA4, a regulator of embryogenesis.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26104682 2015 YY1 regulates melanoma tumorigenesis through a miR-9?~?RYBP axis.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25416956 2014 A proteome-scale map of the human interactome network.
25344099 2014 RYBP expression is associated with better survival of patients with hepatocellular carcinoma (HCC) and responsiveness to chemotherapy of HCC cells in vitro and in vivo.
24855944 2014 The TRPM7 chanzyme is cleaved to release a chromatin-modifying kinase.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22723975 2012 Polymorphisms in RYBP and AOAH genes are associated with chronic rhinosinusitis in a Chinese population: a replication study.
More...