Property Summary

NCBI Gene PubMed Count 32
PubMed Score 63.03
PubTator Score 27.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
acute quadriplegic myopathy 1.023 4.2e-07
adult high grade glioma -1.200 2.3e-04
astrocytic glioma -2.000 1.3e-02
Astrocytoma, Pilocytic -1.100 1.0e-05
atypical teratoid / rhabdoid tumor -1.500 3.7e-06
dermatomyositis 1.200 6.7e-04
ependymoma -1.400 1.9e-10
glioblastoma -1.200 2.0e-07
group 4 medulloblastoma 1.200 1.8e-04
juvenile dermatomyositis 1.006 1.2e-11
lung cancer -1.400 1.2e-02
medulloblastoma, large-cell -1.100 4.1e-03
Multiple myeloma 1.408 2.0e-02
oligodendroglioma -1.500 3.6e-02
osteosarcoma 2.156 2.3e-06
ovarian cancer 1.400 1.3e-03
pancreatic cancer 1.300 9.2e-03
Pick disease 1.200 1.1e-03
primary pancreatic ductal adenocarcinoma 1.153 4.6e-03
psoriasis 1.600 1.8e-04
spina bifida -1.725 3.6e-02
tuberculosis -1.400 1.9e-06

Gene RIF (15)

AA Sequence

MTMGDKKSPTRPKRQAKPAADEGFWDCSVCTFRNSAEAFKCSICDVRKGTSTRKPRINSQLVAQQVAQQY      1 - 70
ATPPPPKKEKKEKVEKQDKEKPEKDKEISPSVTKKNTNKKTKPKSDILKDPPSEANSIQSANATTKTSET     71 - 140
NHTSRPRLKNVDRSTAQQLAVTVGNVTVIITDFKEKTRSSSTSSSTVTSSAGSEQQNQSSSGSESTDKGS    141 - 210
SRSSTPKGDMSAVNDESF                                                        211 - 228
//

Text Mined References (41)

PMID Year Title