Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.61
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
adult high grade glioma -4.100 1.2e-06
astrocytic glioma -3.500 1.3e-03
Astrocytoma, Pilocytic -4.600 3.4e-12
atypical teratoid / rhabdoid tumor -4.800 1.0e-11
Breast cancer -1.400 1.6e-04
Endometriosis -1.951 2.4e-02
ependymoma -4.600 1.0e-03
gastric carcinoma -4.200 1.3e-02
glioblastoma -3.700 8.2e-10
group 3 medulloblastoma -2.700 5.0e-03
intraductal papillary-mucinous adenoma (... 2.300 3.5e-03
intraductal papillary-mucinous neoplasm ... 2.300 1.9e-03
lung adenocarcinoma 1.100 1.9e-02
medulloblastoma, large-cell -3.900 1.0e-07
nasopharyngeal carcinoma -2.100 2.8e-09
non-small cell lung cancer -1.135 6.6e-04
oligodendroglioma -2.600 8.8e-03
osteosarcoma -2.509 3.5e-05
ovarian cancer -2.700 1.5e-08
pancreatic cancer 1.200 3.8e-03
Pick disease -1.600 2.1e-02
primitive neuroectodermal tumor -4.100 2.2e-05
psoriasis -1.500 3.9e-22
spina bifida -1.800 4.2e-02
subependymal giant cell astrocytoma -3.941 3.1e-03

Gene RIF (2)

AA Sequence

MGCDGRVSGLLRRNLQPTLTYWSVFFSFGLCIAFLGPTLLDLRCQTHSSLPQISWVFFSQQLCLLLGSAL      1 - 70
GGVFKRTLAQSLWALFTSSLAISLVFAVIPFCRDVKVLASVMALAGLAMGCIDTVANMQLVRMYQKDSAV     71 - 140
FLQVLHFFVGFGALLSPLIADPFLSEANCLPANSTANTTSRGHLFHVSRVLGQHHVDAKPWSNQTFPGLT    141 - 210
PKDGAGTRVSYAFWIMALINLPVPMAVLMLLSKERLLTCCPQRRPLLLSADELALETQPPEKEDASSLPP    211 - 280
KFQSHLGHEDLFSCCQRKNLRGAPYSFFAIHITGALVLFMTDGLTGAYSAFVYSYAVEKPLSVGHKVAGY    281 - 350
LPSLFWGFITLGRLLSIPISSRMKPATMVFINVVGVVVTFLVLLIFSYNVVFLFVGTASLGLFLSSTFPS    351 - 420
MLAYTEDSLQYKGCATTVLVTGAGVGEMVLQMLVGSIFQAQGSYSFLVCGVIFGCLAFTFYILLLFFHRM    421 - 490
HPGLPSVPTQDRSIGMENSECYQR                                                  491 - 514
//

Text Mined References (8)

PMID Year Title