Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.11
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
oligodendroglioma 2849 8.02215840180443E-20
pilocytic astrocytoma 3086 2.54932839451164E-12
atypical teratoid / rhabdoid tumor 4369 1.01920544959776E-11
psoriasis 6685 3.00189659016807E-10
nasopharyngeal carcinoma 1056 2.84999486441815E-9
sonic hedgehog group medulloblastoma 1482 3.81185554843263E-9
pediatric high grade glioma 2712 5.04105005150784E-9
ovarian cancer 8492 1.509881790502E-8
glioblastoma 5572 1.6657572270141E-8
medulloblastoma, large-cell 6234 1.02962131350131E-7
primitive neuroectodermal tumor 3031 2.15971195469618E-5
osteosarcoma 7933 3.477171153319E-5
Breast cancer 3099 1.62228267850604E-4
non-small cell lung cancer 2798 6.56653679121754E-4
ependymoma 2514 9.991391219439E-4
Pick disease 1893 0.00113803019156419
astrocytic glioma 2241 0.00134072197508978
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.001866332725726
subependymal giant cell astrocytoma 2287 0.00307534712021346
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00351634676733132
pancreatic cancer 2300 0.00384277287906986
gastric carcinoma 832 0.0131836936835486
lung adenocarcinoma 2714 0.0187739178710882
Endometriosis 535 0.0235358902146672
spina bifida 1064 0.041844297942901

Expression

  Differential Expression (25)

Disease log2 FC p
astrocytic glioma -3.500 0.001
ependymoma -4.600 0.001
oligodendroglioma -2.800 0.000
glioblastoma -5.100 0.000
osteosarcoma -2.509 0.000
sonic hedgehog group medulloblastoma -5.300 0.000
atypical teratoid / rhabdoid tumor -4.800 0.000
medulloblastoma, large-cell -3.900 0.000
primitive neuroectodermal tumor -4.100 0.000
non-small cell lung cancer -1.135 0.001
intraductal papillary-mucinous adenoma (... 2.300 0.004
intraductal papillary-mucinous neoplasm ... 2.300 0.002
pancreatic cancer 1.200 0.004
pediatric high grade glioma -4.300 0.000
pilocytic astrocytoma -4.600 0.000
psoriasis -2.400 0.000
subependymal giant cell astrocytoma -3.941 0.003
lung adenocarcinoma 1.100 0.019
nasopharyngeal carcinoma -2.100 0.000
Endometriosis -1.951 0.024
spina bifida -1.800 0.042
Pick disease -2.200 0.001
Breast cancer -1.400 0.000
gastric carcinoma -4.200 0.013
ovarian cancer -2.700 0.000

AA Sequence

MGCDGRVSGLLRRNLQPTLTYWSVFFSFGLCIAFLGPTLLDLRCQTHSSLPQISWVFFSQQLCLLLGSAL      1 - 70
GGVFKRTLAQSLWALFTSSLAISLVFAVIPFCRDVKVLASVMALAGLAMGCIDTVANMQLVRMYQKDSAV     71 - 140
FLQVLHFFVGFGALLSPLIADPFLSEANCLPANSTANTTSRGHLFHVSRVLGQHHVDAKPWSNQTFPGLT    141 - 210
PKDGAGTRVSYAFWIMALINLPVPMAVLMLLSKERLLTCCPQRRPLLLSADELALETQPPEKEDASSLPP    211 - 280
KFQSHLGHEDLFSCCQRKNLRGAPYSFFAIHITGALVLFMTDGLTGAYSAFVYSYAVEKPLSVGHKVAGY    281 - 350
LPSLFWGFITLGRLLSIPISSRMKPATMVFINVVGVVVTFLVLLIFSYNVVFLFVGTASLGLFLSSTFPS    351 - 420
MLAYTEDSLQYKGCATTVLVTGAGVGEMVLQMLVGSIFQAQGSYSFLVCGVIFGCLAFTFYILLLFFHRM    421 - 490
HPGLPSVPTQDRSIGMENSECYQR                                                  491 - 514
//

Text Mined References (6)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.