Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.65
PubTator Score 1.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
breast carcinoma 1614 9.80928439934853E-20
psoriasis 6685 1.31764655071141E-16
cystic fibrosis 1670 4.14971806356605E-6
medulloblastoma, large-cell 6234 2.60960875044654E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.21843670989627E-5
osteosarcoma 7933 4.41149149427252E-5
group 3 medulloblastoma 2254 1.35139402470477E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 1.36356880409083E-4
invasive ductal carcinoma 2950 1.37339504641408E-4
pediatric high grade glioma 2712 8.22741722411253E-4
ductal carcinoma in situ 1745 0.00407251163421471
glioblastoma 5572 0.00491751337187779
inflammatory breast cancer 404 0.00743276124540134
atypical teratoid / rhabdoid tumor 4369 0.00750855703026907
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00967917750766346
astrocytic glioma 2241 0.0195559129046677
Atopic dermatitis 944 0.0262977205176507
Pick disease 1893 0.0438354933801952
Disease Target Count Z-score Confidence
Diabetic cataract 6 3.933 2.0
Brachydactyly 52 3.2 1.6

Expression

Synonym

Accession Q8N428 Q4KMG3 Q58A55 Q9ULT9
Symbols GALNTL1
GALNACT16
GalNAc-T16

Gene

PANTHER Protein Class (2)

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid

 GO Process (1)

 GWAS Trait (1)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MRKIRANAIAILTVAWILGTFYYLWQDNRAHAASSGGRGAQRAGRRSEQLREDRTIPLIVTGTPSKGFDE      1 - 70
KAYLSAKQLKAGEDPYRQHAFNQLESDKLSPDRPIRDTRHYSCPSVSYSSDLPATSVIITFHNEARSTLL     71 - 140
RTVKSVLNRTPANLIQEIILVDDFSSDPEDCLLLTRIPKVKCLRNDRREGLIRSRVRGADVAAATVLTFL    141 - 210
DSHCEVNTEWLPPMLQRVKEDHTRVVSPIIDVISLDNFAYLAASADLRGGFDWSLHFKWEQIPLEQKMTR    211 - 280
TDPTRPIRTPVIAGGIFVIDKSWFNHLGKYDAQMDIWGGENFELSFRVWMCGGSLEIVPCSRVGHVFRKR    281 - 350
HPYNFPEGNALTYIRNTKRTAEVWMDEYKQYYYEARPSAIGKAFGSVATRIEQRKKMNCKSFRWYLENVY    351 - 420
PELTVPVKEALPGIIKQGVNCLESQGQNTAGDFLLGMGICRGSAKNPQPAQAWLFSDHLIQQQGKCLAAT    421 - 490
STLMSSPGSPVILQMCNPREGKQKWRRKGSFIQHSVSGLCLETKPAQLVTSKCQADAQAQQWQLLPHT      491 - 558
//

Text Mined References (8)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22186971 2012 UDP-N-acetyl-?-D-galactosamine:polypeptide N-acetylgalactosaminyltransferases: completion of the family tree.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10574461 1999 Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain.