Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.26
PubTator Score 4.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Gene RIF (4)

AA Sequence

MSFNLQSSKKLFIFLGKSLFSLLEAMIFALLPKPRKNVAGEIVLITGAGSGLGRLLALQFARLGSVLVLW      1 - 70
DINKEGNEETCKMAREAGATRVHAYTCDCSQKEGVYRVADQVKKEVGDVSILINNAGIVTGKKFLDCPDE     71 - 140
LMEKSFDVNFKAHLWTYKAFLPAMIANDHGHLVCISSSAGLSGVNGLADYCASKFAAFGFAESVFVETFV    141 - 210
QKQKGIKTTIVCPFFIKTGMFEGCTTGCPSLLPILEPKYAVEKIVEAILQEKMYLYMPKLLYFMMFLKSF    211 - 280
LPLKTGLLIADYLGILHAMDGFVDQKKKL                                             281 - 309
//

Text Mined References (16)

PMID Year Title