Property Summary

NCBI Gene PubMed Count 14
Grant Count 3
R01 Count 3
Funding $251,066.8
PubMed Score 5.21
PubTator Score 4.06

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8N3Y7 B4DGK2 Q330K3 Q8TDV9 Q96LX1 EPHD-2
Symbols RDH#2
RDHE2
EPHD-2
RDH-E2
retSDR2

Gene

PANTHER Protein Class (2)

Gene RIF (4)

PMID Text
20546612 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15457346 Observational study of gene-disease association. (HuGE Navigator)
12372410 mapped to chromosome 8; may be involved in the pathogenesis of psoriasis through its critical role in retinol metabolism in keratinocyte proliferation

AA Sequence

MSFNLQSSKKLFIFLGKSLFSLLEAMIFALLPKPRKNVAGEIVLITGAGSGLGRLLALQFARLGSVLVLW      1 - 70
DINKEGNEETCKMAREAGATRVHAYTCDCSQKEGVYRVADQVKKEVGDVSILINNAGIVTGKKFLDCPDE     71 - 140
LMEKSFDVNFKAHLWTYKAFLPAMIANDHGHLVCISSSAGLSGVNGLADYCASKFAAFGFAESVFVETFV    141 - 210
QKQKGIKTTIVCPFFIKTGMFEGCTTGCPSLLPILEPKYAVEKIVEAILQEKMYLYMPKLLYFMMFLKSF    211 - 280
LPLKTGLLIADYLGILHAMDGFVDQKKKL                                             281 - 309
//

Text Mined References (15)

PMID Year Title
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19102727 2009 Characterization of key residues and membrane association domains in retinol dehydrogenase 10.
18926804 2009 Biochemical characterization of human epidermal retinol dehydrogenase 2.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18391950 2008 Identification of ten loci associated with height highlights new biological pathways in human growth.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...