Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.21
PubTator Score 4.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 2.41626141934076E-22
ependymoma 2514 8.3940122134707E-22
medulloblastoma 1524 3.60076856667667E-11
pilocytic astrocytoma 3086 6.42838235168465E-9
pancreatic cancer 2300 1.5192909022085E-8
non-small cell lung cancer 2798 2.5388743114573E-8
primitive neuroectodermal tumor 3031 1.73992256163337E-7
lung adenocarcinoma 2714 3.2037787813257E-7
pediatric high grade glioma 2712 3.78790237936735E-6
glioblastoma 5572 7.37633548587109E-6
medulloblastoma, large-cell 6234 1.22781640296237E-5
nasopharyngeal carcinoma 1056 3.34616476852631E-5
atypical teratoid / rhabdoid tumor 4369 7.52265594093964E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 8.14398961326151E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 2.18914047989664E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 8.37012906937034E-4
active ulcerative colitis 477 0.00637606559067656
astrocytic glioma 2241 0.00671233938557571
oligodendroglioma 2849 0.00677864812968308
spina bifida 1064 0.023490066253687
active Crohn's disease 918 0.0239250634532367
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0347192628993322
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0
Disease Target Count Z-score Confidence
psoriasis 6685 3.086 1.5

Expression

Synonym

Accession Q8N3Y7 B4DGK2 Q330K3 Q8TDV9 Q96LX1 EPHD-2
Symbols RDH#2
RDHE2
EPHD-2
RDH-E2
retSDR2

Gene

PANTHER Protein Class (2)

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid

Gene RIF (4)

PMID Text
20546612 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15457346 Observational study of gene-disease association. (HuGE Navigator)
12372410 mapped to chromosome 8; may be involved in the pathogenesis of psoriasis through its critical role in retinol metabolism in keratinocyte proliferation

AA Sequence

MSFNLQSSKKLFIFLGKSLFSLLEAMIFALLPKPRKNVAGEIVLITGAGSGLGRLLALQFARLGSVLVLW      1 - 70
DINKEGNEETCKMAREAGATRVHAYTCDCSQKEGVYRVADQVKKEVGDVSILINNAGIVTGKKFLDCPDE     71 - 140
LMEKSFDVNFKAHLWTYKAFLPAMIANDHGHLVCISSSAGLSGVNGLADYCASKFAAFGFAESVFVETFV    141 - 210
QKQKGIKTTIVCPFFIKTGMFEGCTTGCPSLLPILEPKYAVEKIVEAILQEKMYLYMPKLLYFMMFLKSF    211 - 280
LPLKTGLLIADYLGILHAMDGFVDQKKKL                                             281 - 309
//

Text Mined References (15)

PMID Year Title
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19102727 2009 Characterization of key residues and membrane association domains in retinol dehydrogenase 10.
18926804 2009 Biochemical characterization of human epidermal retinol dehydrogenase 2.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18391950 2008 Identification of ten loci associated with height highlights new biological pathways in human growth.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...