Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.64
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -3.300 0.002
ependymoma -4.900 0.000
oligodendroglioma -2.700 0.000
glioblastoma -3.900 0.000
sonic hedgehog group medulloblastoma -3.400 0.000
atypical teratoid / rhabdoid tumor -4.600 0.000
medulloblastoma, large-cell -3.800 0.000
primitive neuroectodermal tumor -2.600 0.007
adult high grade glioma -3.900 0.000
pilocytic astrocytoma -3.200 0.000
invasive ductal carcinoma -1.193 0.007
non-inflammatory breast cancer -2.400 0.000
pituitary cancer 1.200 0.000
psoriasis -1.500 0.000

AA Sequence

MAQAVWSRLGRILWLACLLPWAPAGVAAGLYELNLTTDSPATTGAVVTISASLVAKDNGSLALPADAHLY      1 - 70
RFHWIHTPLVLTGKMEKGLSSTIRVVGHVPGEFPVSVWVTAADCWMCQPVARGFVVLPITEFLVGDLVVT     71 - 140
QNTSLPWPSSYLTKTVLKVSFLLHDPSNFLKTALFLYSWDFGDGTQMVTEDSVVYYNYSIIGTFTVKLKV    141 - 210
VAEWEEVEPDATRAVKQKTGDFSASLKLQETLRGIQVLGPTLIQTFQKMTVTLNFLGSPPLTVCWRLKPE    211 - 280
CLPLEEGECHPVSVASTAYNLTHTFRDPGDYCFSIRAENIISKTHQYHKIQVWPSRIQPAVFAFPCATLI    281 - 350
TVMLAFIMYMTLRNATQQKDMVEVADFDFSPMSDKNPEPPSGVRCCCQMCCGPFLLETPSEYLEIVRENH    351 - 420
GLLPPLYKSVKTYTV                                                           421 - 435
//

Text Mined References (13)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
More...