Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.64
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -3.900 4.3e-07
astrocytic glioma -3.300 2.4e-03
Astrocytoma, Pilocytic -3.400 8.8e-08
atypical teratoid / rhabdoid tumor -4.600 6.2e-12
ependymoma -3.900 9.5e-04
glioblastoma -3.700 3.0e-10
group 3 medulloblastoma -3.300 1.5e-04
inflammatory breast cancer -2.200 1.6e-05
invasive ductal carcinoma -1.193 7.3e-03
medulloblastoma, large-cell -3.800 4.2e-05
oligodendroglioma -2.600 1.4e-02
pituitary cancer 1.200 1.3e-05
primitive neuroectodermal tumor -2.600 6.9e-03
psoriasis -1.500 8.5e-30

AA Sequence

MAQAVWSRLGRILWLACLLPWAPAGVAAGLYELNLTTDSPATTGAVVTISASLVAKDNGSLALPADAHLY      1 - 70
RFHWIHTPLVLTGKMEKGLSSTIRVVGHVPGEFPVSVWVTAADCWMCQPVARGFVVLPITEFLVGDLVVT     71 - 140
QNTSLPWPSSYLTKTVLKVSFLLHDPSNFLKTALFLYSWDFGDGTQMVTEDSVVYYNYSIIGTFTVKLKV    141 - 210
VAEWEEVEPDATRAVKQKTGDFSASLKLQETLRGIQVLGPTLIQTFQKMTVTLNFLGSPPLTVCWRLKPE    211 - 280
CLPLEEGECHPVSVASTAYNLTHTFRDPGDYCFSIRAENIISKTHQYHKIQVWPSRIQPAVFAFPCATLI    281 - 350
TVMLAFIMYMTLRNATQQKDMVEVADFDFSPMSDKNPEPPSGVRCCCQMCCGPFLLETPSEYLEIVRENH    351 - 420
GLLPPLYKSVKTYTV                                                           421 - 435
//

Text Mined References (13)

PMID Year Title