Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.64
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 8.45720549804543E-30
ependymoma 2514 1.30919121018313E-22
oligodendroglioma 2849 1.56947244290253E-19
atypical teratoid / rhabdoid tumor 4369 6.23017823059517E-12
non-inflammatory breast cancer 208 1.29047079462581E-7
pilocytic astrocytoma 3086 1.5175440528791E-7
adult high grade glioma 2148 4.33454911962298E-7
glioblastoma 5572 5.52117413512265E-7
sonic hedgehog group medulloblastoma 1482 2.18252215369875E-6
pituitary cancer 1972 1.28864019949173E-5
medulloblastoma, large-cell 6234 4.21406922278434E-5
astrocytic glioma 2241 0.00238502621885885
primitive neuroectodermal tumor 3031 0.00694064300049298
invasive ductal carcinoma 2950 0.00730822821215456

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -3.300 0.002
ependymoma -4.900 0.000
oligodendroglioma -2.700 0.000
glioblastoma -3.900 0.000
sonic hedgehog group medulloblastoma -3.400 0.000
atypical teratoid / rhabdoid tumor -4.600 0.000
medulloblastoma, large-cell -3.800 0.000
primitive neuroectodermal tumor -2.600 0.007
adult high grade glioma -3.900 0.000
pilocytic astrocytoma -3.200 0.000
invasive ductal carcinoma -1.193 0.007
non-inflammatory breast cancer -2.400 0.000
pituitary cancer 1.200 0.000
psoriasis -1.500 0.000

Synonym

Accession Q8N3G9 A4D266 B7Z364 Q8IY46 Q8N0W9 Q8N3R2
Symbols

Gene

  Ortholog (8)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid

AA Sequence

MAQAVWSRLGRILWLACLLPWAPAGVAAGLYELNLTTDSPATTGAVVTISASLVAKDNGSLALPADAHLY      1 - 70
RFHWIHTPLVLTGKMEKGLSSTIRVVGHVPGEFPVSVWVTAADCWMCQPVARGFVVLPITEFLVGDLVVT     71 - 140
QNTSLPWPSSYLTKTVLKVSFLLHDPSNFLKTALFLYSWDFGDGTQMVTEDSVVYYNYSIIGTFTVKLKV    141 - 210
VAEWEEVEPDATRAVKQKTGDFSASLKLQETLRGIQVLGPTLIQTFQKMTVTLNFLGSPPLTVCWRLKPE    211 - 280
CLPLEEGECHPVSVASTAYNLTHTFRDPGDYCFSIRAENIISKTHQYHKIQVWPSRIQPAVFAFPCATLI    281 - 350
TVMLAFIMYMTLRNATQQKDMVEVADFDFSPMSDKNPEPPSGVRCCCQMCCGPFLLETPSEYLEIVRENH    351 - 420
GLLPPLYKSVKTYTV                                                           421 - 435
//

Text Mined References (13)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
More...