Property Summary

NCBI Gene PubMed Count 22
PubMed Score 17.52
PubTator Score 14.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
active Crohn's disease -1.681 1.4e-02
astrocytic glioma 1.700 2.1e-02
atypical teratoid/rhabdoid tumor -1.200 1.2e-05
ependymoma 2.200 2.2e-02
glioblastoma 1.100 9.1e-04
group 3 medulloblastoma -2.200 7.1e-03
interstitial cystitis -1.500 1.4e-03
medulloblastoma, large-cell -1.200 4.7e-04
oligodendroglioma 1.700 3.1e-02
osteosarcoma 1.588 4.4e-06
ovarian cancer 1.300 2.3e-09
pediatric high grade glioma 1.100 2.1e-02

 GWAS Trait (1)

Gene RIF (17)

AA Sequence

MLCGRWRRCRRPPEEPPVAAQVAAQVAAPVALPSPPTPSDGGTKRPGLRALKKMGLTEDEDVRAMLRGSR      1 - 70
LRKIRSRTWHKERLYRLQEDGLSVWFQRRIPRAPSQHIFFVQHIEAVREGHQSEGLRRFGGAFAPARCLT     71 - 140
IAFKGRRKNLDLAAPTAEEAQRWVRGLTKLRARLDAMSQRERLDHWIHSYLHRADSNQDSKMSFKEIKSL    141 - 210
LRMVNVDMNDMYAYLLFKECDHSNNDRLEGAEIEEFLRRLLKRPELEEIFHQYSGEDRVLSAPELLEFLE    211 - 280
DQGEEGATLARAQQLIQTYELNETAKQHELMTLDGFMMYLLSPEGAALDNTHTCVFQDMNQPLAHYFISS    281 - 350
SHNTYLTDSQIGGPSSTEAYVRAFAQGCRCVELDCWEGPGGEPVIYHGHTLTSKILFRDVVQAVRDHAFT    351 - 420
LSPYPVILSLENHCGLEQQAAMARHLCTILGDMLVTQALDSPNPEELPSPEQLKGRVLVKGKKLPAARSE    421 - 490
DGRALSDREEEEEDDEEEEEEVEAAAQRRLAKQISPELSALAVYCHATRLRTLHPAPNAPQPCQVSSLSE    491 - 560
RKAKKLIREAGNSFVRHNARQLTRVYPLGLRMNSANYSPQEMWNSGCQLVALNFQTPGYEMDLNAGRFLV    561 - 630
NGQCGYVLKPACLRQPDSTFDPEYPGPPRTTLSIQVLTAQQLPKLNAEKPHSIVDPLVRIEIHGVPADCA    631 - 700
RQETDYVLNNGFNPRWGQTLQFQLRAPELALVRFVVEDYDATSPNDFVGQFTLPLSSLKQGYRHIHLLSK    701 - 770
DGASLSPATLFIQIRIQRS                                                       771 - 789
//

Text Mined References (30)

PMID Year Title