Property Summary

NCBI Gene PubMed Count 22
PubMed Score 16.80
PubTator Score 14.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 1.700 0.021
ependymoma 2.200 0.022
oligodendroglioma 1.700 0.031
osteosarcoma 1.588 0.000
group 3 medulloblastoma -2.200 0.007
glioblastoma 1.100 0.001
medulloblastoma, large-cell -1.200 0.000
active Crohn's disease -1.681 0.014
interstitial cystitis -1.500 0.001
pediatric high grade glioma 1.100 0.021
atypical teratoid/rhabdoid tumor -1.200 0.000
ovarian cancer 1.300 0.000

Synonym

Accession Q8N3E9 Q8TEC1 Q8TF37 Q96FL6
Symbols PLC-delta-3

Gene

 GWAS Trait (1)

Gene RIF (17)

PMID Text
23948486 PLCdelta3 regulates microvilli formation in enterocytes and the radial migration of neurons in the cerebral cortex of the developing brain. [review]
22723964 In mouse, Plcd1 and Plcd3 may act together in murine hair follicles.
21951552 HIV-1 Tat induces release of calcium and TNF-alpha production, an effect mediated at least in part by activation of phospholipase C
20852445 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19430483 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
19344632 Data are consistent with the idea that phospholipase C d1 and d3 isoforms support the growth and migration of normal and neoplastic mammary epithelial cells in vitro.
19329342 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MLCGRWRRCRRPPEEPPVAAQVAAQVAAPVALPSPPTPSDGGTKRPGLRALKKMGLTEDEDVRAMLRGSR      1 - 70
LRKIRSRTWHKERLYRLQEDGLSVWFQRRIPRAPSQHIFFVQHIEAVREGHQSEGLRRFGGAFAPARCLT     71 - 140
IAFKGRRKNLDLAAPTAEEAQRWVRGLTKLRARLDAMSQRERLDHWIHSYLHRADSNQDSKMSFKEIKSL    141 - 210
LRMVNVDMNDMYAYLLFKECDHSNNDRLEGAEIEEFLRRLLKRPELEEIFHQYSGEDRVLSAPELLEFLE    211 - 280
DQGEEGATLARAQQLIQTYELNETAKQHELMTLDGFMMYLLSPEGAALDNTHTCVFQDMNQPLAHYFISS    281 - 350
SHNTYLTDSQIGGPSSTEAYVRAFAQGCRCVELDCWEGPGGEPVIYHGHTLTSKILFRDVVQAVRDHAFT    351 - 420
LSPYPVILSLENHCGLEQQAAMARHLCTILGDMLVTQALDSPNPEELPSPEQLKGRVLVKGKKLPAARSE    421 - 490
DGRALSDREEEEEDDEEEEEEVEAAAQRRLAKQISPELSALAVYCHATRLRTLHPAPNAPQPCQVSSLSE    491 - 560
RKAKKLIREAGNSFVRHNARQLTRVYPLGLRMNSANYSPQEMWNSGCQLVALNFQTPGYEMDLNAGRFLV    561 - 630
NGQCGYVLKPACLRQPDSTFDPEYPGPPRTTLSIQVLTAQQLPKLNAEKPHSIVDPLVRIEIHGVPADCA    631 - 700
RQETDYVLNNGFNPRWGQTLQFQLRAPELALVRFVVEDYDATSPNDFVGQFTLPLSSLKQGYRHIHLLSK    701 - 770
DGASLSPATLFIQIRIQRS                                                       771 - 789
//

Text Mined References (30)

PMID Year Title
23948486 2013 Physiological functions of phospholipase C?1 and phospholipase C?3.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22723964 2012 Alopecia in a viable phospholipase C delta 1 and phospholipase C delta 3 double mutant.
21472267 Gene expression analysis reveals novel altered genes in nasal polyps.
21035487 2011 Phospholipase C?3 is a novel binding partner of myosin VI and functions as anchoring of myosin VI on plasma membrane.
20852445 2011 Common variants in or near FGF5, CYP17A1 and MTHFR genes are associated with blood pressure and hypertension in Chinese Hans.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
More...