Property Summary

NCBI Gene PubMed Count 6
PubMed Score 160.48
PubTator Score 46.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma 2.200 4.8e-04
atypical teratoid / rhabdoid tumor 1.900 8.6e-04
glioblastoma 1.900 5.2e-05
interstitial cystitis 1.100 5.4e-05
medulloblastoma 1.200 1.9e-02
medulloblastoma, large-cell 2.600 6.8e-05
mucosa-associated lymphoid tissue lympho... 1.510 2.3e-02
ovarian cancer 2.500 2.0e-11
Rheumatoid arthritis -1.500 1.5e-02

AA Sequence

MGGTLAWTLLLPLLLRESDSLEPSCTVSSADVDWNAEFSATCLNFSGLSLSLPHNQSLRASNVILLDLSG      1 - 70
NGLRELPVTFFAHLQKLEVLNVLRNPLSRVDGALAARCDLDLQADCNCALESWHDIRRDNCSGQKPLLCW     71 - 140
DTTSSQHNLSAFLEVSCAPGLASATIGAVVVSGCLLLGLAIAGPVLAWRLWRCRVARSRELNKPWAAQDG    141 - 210
PKPGLGLQPRYGSRSAPKPQVAVPSCPSTPDYENMFVGQPAAEHQWDEQGAHPSEDNDFYINYKDIDLAS    211 - 280
QPVYCNLQSLGQAPMDEEEYVIPGH                                                 281 - 305
//

Text Mined References (7)

PMID Year Title