Property Summary

NCBI Gene PubMed Count 6
PubMed Score 146.68
PubTator Score 46.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 2.02211223888671E-11
glioblastoma 5572 5.22833270202714E-5
interstitial cystitis 2299 5.38543229748181E-5
medulloblastoma, large-cell 6234 6.83025143597019E-5
adult high grade glioma 2148 4.79335720820615E-4
atypical teratoid / rhabdoid tumor 4369 8.58606354315437E-4
Rheumatoid Arthritis 1171 0.0152689750363558
medulloblastoma 1524 0.0185548284658732
mucosa-associated lymphoid tissue lymphoma 480 0.0228221591521875
Disease Target Count Z-score Confidence
Glanders 5 3.764 1.9
psoriasis 6685 3.269 1.6
Botulism 20 3.109 1.6

Expression

  Differential Expression (9)

Synonym

Accession Q8N386 Q6IQ00 Q8N9A5
Symbols MAPA

Gene

  Ortholog (7)

 CSPA Cell Line (2)

AA Sequence

MGGTLAWTLLLPLLLRESDSLEPSCTVSSADVDWNAEFSATCLNFSGLSLSLPHNQSLRASNVILLDLSG      1 - 70
NGLRELPVTFFAHLQKLEVLNVLRNPLSRVDGALAARCDLDLQADCNCALESWHDIRRDNCSGQKPLLCW     71 - 140
DTTSSQHNLSAFLEVSCAPGLASATIGAVVVSGCLLLGLAIAGPVLAWRLWRCRVARSRELNKPWAAQDG    141 - 210
PKPGLGLQPRYGSRSAPKPQVAVPSCPSTPDYENMFVGQPAAEHQWDEQGAHPSEDNDFYINYKDIDLAS    211 - 280
QPVYCNLQSLGQAPMDEEEYVIPGH                                                 281 - 305
//

Text Mined References (7)

PMID Year Title
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12384430 2002 Subtractive hybridization reveals the expression of immunoglobulin-like transcript 7, Eph-B1, granzyme B, and 3 novel transcripts in human plasmacytoid dendritic cells.