Property Summary

NCBI Gene PubMed Count 22
PubMed Score 46.21
PubTator Score 12.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.410 0.010

Synonym

Accession Q8N371 B4DLU9 Q6VAK5 Q9H8B1
Symbols JMJD5

Gene

PDB

3UYJ   4AAP   4GAZ   4GJY   4GJZ   4QU1  

 GWAS Trait (1)

Gene RIF (14)

PMID Text
26792738 These results suggest that direct interaction of JMJD5 with HBx facilitates hepatitis B virus replication through the hydroxylase activity of JMJD5.
26710852 Data suggest that JMJD5 partially accumulates on mitotic spindles during mitosis; depletion of JMJD5 results in significant mitotic arrest, spindle assembly defects, and sustained activation of spindle assembly checkpoint.
26261525 Suggest JMJD5 as a potential oncogene in colon carcinogenesis.
26025680 results reveal that JMJD5 is a novel binding partner of p53 and it functions as a positive modulator of cell cycle and cell proliferation mainly through the repression of p53 pathway.
24981860 RCCD1 and KDM8 form a histone demethylase complex.
24740926 we provide genetic and biochemical evidence that the JMJD5/CDKN1A (p21) axis is essential to maintaining the short G1 phase which is critical for pluripotency in human embryonic stem cells
24344305 JMJD5 has a role in regulating PKM2 nuclear translocation and reprogramming HIF-1alpha-mediated glucose metabolism
24100311 Comparison of the structure of JMJD5 with that of FIH, a well characterized protein hydroxylase, reveals that human JMJD5 might function as a protein hydroxylase.
23948433 These results reveal that the N-terminal domain is essential for the nuclear localization of JMJD5 and its normal enzymatic function towards substrates in the nucleus
22851697 The study reports high-resolution crystal structures of the human JMJD5 catalytic domain in complex with the substrate 2-oxoglutarate (2-OG) and the inhibitor N-oxalylglycine (NOG).
More...

AA Sequence

MAGDTHCPAEPLAREGTLWEALRALLPHSKEDLKLDLGEKVERSVVTLLQRATELFYEGRRDECLQSSEV      1 - 70
ILDYSWEKLNTGTWQDVDKDWRRVYAIGCLLKALCLCQAPEDANTVAAALRVCDMGLLMGAAILGDILLK     71 - 140
VAAILQTHLPGKRPARGSLPEQPCTKKARADHGLIPDVKLEKTVPRLHRPSLQHFREQFLVPGRPVILKG    141 - 210
VADHWPCMQKWSLEYIQEIAGCRTVPVEVGSRYTDEEWSQTLMTVNEFISKYIVNEPRDVGYLAQHQLFD    211 - 280
QIPELKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLYSPQESGALY    281 - 350
PHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWHYVRALDLSFSVSFWWS        351 - 416
//

Text Mined References (24)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26792738 2016 Hepatocyte Factor JMJD5 Regulates Hepatitis B Virus Replication through Interaction with HBx.
26710852 2016 JMJD5 (Jumonji Domain-containing 5) Associates with Spindle Microtubules and Is Required for Proper Mitosis.
26261525 2015 JMJD5 is a potential oncogene for colon carcinogenesis.
26025680 2015 JMJD5 interacts with p53 and negatively regulates p53 function in control of cell cycle and proliferation.
24981860 2014 Human-chromatin-related protein interactions identify a demethylase complex required for chromosome segregation.
24740926 2014 JMJD5 regulates cell cycle and pluripotency in human embryonic stem cells.
24344305 2014 JMJD5 regulates PKM2 nuclear translocation and reprograms HIF-1?-mediated glucose metabolism.
24100311 2013 Structure of the JmjC-domain-containing protein JMJD5.
23948433 2013 Identification and functional implication of nuclear localization signals in the N-terminal domain of JMJD5.
More...