Property Summary

NCBI Gene PubMed Count 10
PubMed Score 101.35
PubTator Score 12.40

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.200 5.8e-04
atypical teratoid / rhabdoid tumor -1.200 3.8e-05
diabetes mellitus 1.500 1.1e-03
group 4 medulloblastoma -1.500 1.2e-06
medulloblastoma, large-cell -1.900 6.8e-05
osteosarcoma -2.018 7.2e-09
posterior fossa group A ependymoma 1.200 2.5e-07
tuberculosis -1.300 1.1e-06

Gene RIF (4)

AA Sequence

MAPTLATAHRRRWWMACTAVLENLLFSAVLLGWGSLLIMLKSEGFYSYLCTEPENVTNGTVGGTAEPGHE      1 - 70
EVSWMNGWLSCQAQDEMLNLAFTVGSFLLSAITLPLGIVMDKYGPRKLRLLGSACFAVSCLLIAYGASKP     71 - 140
NALSVLIFIALALNGFGGMCMTFTSLTLPNMFGDLRSTFIALMIGSYASSAVTFPGIKLIYDAGVSFIVV    141 - 210
LVVWAGCSGLVFLNCFFNWPLEPFPGPEDMDYSVKIKFSWLGFDHKITGKQFYKQVTTVGRRLSVGSSMR    211 - 280
SAKEQVALQEGHKLCLSTVDLEVKCQPDAAVAPSFMHSVFSPILLLSLVTMCVTQLRLIFYMGAMNNILK    281 - 350
FLVSGDQKTVGLYTSIFGVLQLLCLLTAPVIGYIMDWRLKECEDASEEPEEKDANQGEKKKKKRDRQIQK    351 - 420
ITNAMRAFAFTNLLLVGFGVTCLIPNLPLQILSFILHTIVRGFIHSAVGGLYAAVYPSTQFGSLTGLQSL    421 - 490
ISALFALLQQPLFLAMMGPLQGDPLWVNVGLLLLSLLGFCLPLYLICYRRQLERQLQQRQEDDKLFLKIN    491 - 560
GSSNQEAFV                                                                 561 - 569
//

Text Mined References (15)

PMID Year Title