Property Summary

NCBI Gene PubMed Count 10
PubMed Score 97.17
PubTator Score 12.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -2.018 0.000
group 4 medulloblastoma -1.500 0.000
atypical teratoid / rhabdoid tumor -1.200 0.000
medulloblastoma, large-cell -1.900 0.000
tuberculosis -1.700 0.002
diabetes mellitus 1.500 0.001
adult high grade glioma -1.200 0.001
posterior fossa group A ependymoma 1.300 0.000

Gene RIF (4)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
15659399 In situ hybridization experiments show that LAT4 mRNA is restricted to the epithelial cells of the distal tubule and the collecting duct in the kidney. In the intestine, LAT4 is mainly present in the cells of the crypt.

AA Sequence

MAPTLATAHRRRWWMACTAVLENLLFSAVLLGWGSLLIMLKSEGFYSYLCTEPENVTNGTVGGTAEPGHE      1 - 70
EVSWMNGWLSCQAQDEMLNLAFTVGSFLLSAITLPLGIVMDKYGPRKLRLLGSACFAVSCLLIAYGASKP     71 - 140
NALSVLIFIALALNGFGGMCMTFTSLTLPNMFGDLRSTFIALMIGSYASSAVTFPGIKLIYDAGVSFIVV    141 - 210
LVVWAGCSGLVFLNCFFNWPLEPFPGPEDMDYSVKIKFSWLGFDHKITGKQFYKQVTTVGRRLSVGSSMR    211 - 280
SAKEQVALQEGHKLCLSTVDLEVKCQPDAAVAPSFMHSVFSPILLLSLVTMCVTQLRLIFYMGAMNNILK    281 - 350
FLVSGDQKTVGLYTSIFGVLQLLCLLTAPVIGYIMDWRLKECEDASEEPEEKDANQGEKKKKKRDRQIQK    351 - 420
ITNAMRAFAFTNLLLVGFGVTCLIPNLPLQILSFILHTIVRGFIHSAVGGLYAAVYPSTQFGSLTGLQSL    421 - 490
ISALFALLQQPLFLAMMGPLQGDPLWVNVGLLLLSLLGFCLPLYLICYRRQLERQLQQRQEDDKLFLKIN    491 - 560
GSSNQEAFV                                                                 561 - 569
//

Text Mined References (15)

PMID Year Title
23268354 The small SLC43 family: facilitator system l amino acid transporters and the orphan EEG1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21224231 2011 Facilitated transporters mediate net efflux of amino acids to the fetus across the basal membrane of the placental syncytiotrophoblast.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18195088 2008 Amino acid transport across mammalian intestinal and renal epithelia.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
More...