Property Summary

NCBI Gene PubMed Count 8
PubMed Score 250.65
PubTator Score 1.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 1.83428183512206E-11
non-small cell lung cancer 2798 2.94864981234125E-8
pituitary cancer 1972 3.09250470001277E-6
Breast cancer 3099 2.03101551636966E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0125410768475692
spina bifida 1064 0.0453193782314629
Disease Target Count Z-score Confidence
Empty sella syndrome 6 3.788 1.9
Epilepsy 346 3.052 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
non-small cell lung cancer 1.051 0.000
intraductal papillary-mucinous neoplasm ... 1.500 0.013
lung carcinoma 1.500 0.000
spina bifida -1.238 0.045
Breast cancer 1.100 0.000
pituitary cancer 1.600 0.000

Synonym

Accession Q8N365 B2RD43 D3DV01 Q8N795 Q96MG6
Symbols GM129
CHRONO
C1orf51

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG
Anole lizard OMA EggNOG

AA Sequence

MDSPSSVSSYSSYSLSSSFPTSPVNSDFGFPSDSEREDKGAHGPRPDTVGQRGGSRPSPGPIRCRHRSKV      1 - 70
SGNQHTPSHPKQRGSASPMAGSGAKRSRDGELETSLNTQGCTTEGDLLFAQKCKELQGFIPPLTDLLNGL     71 - 140
KMGRFERGLSSFQQSVAMDRIQRIVGVLQKPQMGERYLGTLLQVEGMLKTWFPQIAAQKSSLGGGKHQLT    141 - 210
KHFPSHHSDSAASSPASPMEKMDQTQLGHLALKPKQPWHLTQWPAMNLTWIHTTPICNPPLSSPGTISFS    211 - 280
HGPLGTGTGIGVILFLQHGVQPFTHSAPTTPVPPTTASPVIPGEPMKLSGEGPRCYSLPVTLPSDWSYTL    281 - 350
SPPSLPTLARKMTIGHREQQRSHPPVAADAHLLNL                                       351 - 385
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24736997 2014 A novel protein, CHRONO, functions as a core component of the mammalian circadian clock.
24385426 2014 Gene model 129 (Gm129) encodes a novel transcriptional repressor that modulates circadian gene expression.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.