Property Summary

NCBI Gene PubMed Count 10
PubMed Score 258.62
PubTator Score 1.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer 1.100 2.0e-04
intraductal papillary-mucinous neoplasm ... 1.500 1.3e-02
lung carcinoma 1.500 1.8e-11
non-small cell lung cancer 1.051 2.9e-08
pituitary cancer 1.600 3.1e-06
spina bifida -1.238 4.5e-02

Gene RIF (1)

AA Sequence

MDSPSSVSSYSSYSLSSSFPTSPVNSDFGFPSDSEREDKGAHGPRPDTVGQRGGSRPSPGPIRCRHRSKV      1 - 70
SGNQHTPSHPKQRGSASPMAGSGAKRSRDGELETSLNTQGCTTEGDLLFAQKCKELQGFIPPLTDLLNGL     71 - 140
KMGRFERGLSSFQQSVAMDRIQRIVGVLQKPQMGERYLGTLLQVEGMLKTWFPQIAAQKSSLGGGKHQLT    141 - 210
KHFPSHHSDSAASSPASPMEKMDQTQLGHLALKPKQPWHLTQWPAMNLTWIHTTPICNPPLSSPGTISFS    211 - 280
HGPLGTGTGIGVILFLQHGVQPFTHSAPTTPVPPTTASPVIPGEPMKLSGEGPRCYSLPVTLPSDWSYTL    281 - 350
SPPSLPTLARKMTIGHREQQRSHPPVAADAHLLNL                                       351 - 385
//

Text Mined References (10)

PMID Year Title