Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.30
PubTator Score 0.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 2.8e-58
tuberculosis 2010 4.8e-06
osteosarcoma 7950 3.1e-05
active ulcerative colitis 764 2.1e-02

Expression

  Differential Expression (4)

Disease log2 FC p
active ulcerative colitis 1.327 2.1e-02
osteosarcoma 1.242 3.1e-05
psoriasis 2.500 2.8e-58
tuberculosis -1.200 4.8e-06

AA Sequence

MMPLAEAGALAQGGGPSATEWACILRRKTPRHKQPTLLMVRASRRSGKTSAVLKAGRQSVSGRKNSTSKD      1 - 70
LVTLGASSLREERGHPLHPRHRKAVHLRTRGRTRGWVQTLARMSRRTRGPVERAAAAAAAAAGGDAGHAP     71 - 140
FPPPPAADGARAPRSPGQVTPRGLRLRLPRRESLLRGLCRPLRPLLGFRESDSAKPASLRLLQHTPSARR    141 - 210
NYRIAGARLMRSNYPPPLSSAALRGAGPTRRN                                          211 - 242
//

Text Mined References (4)

PMID Year Title