Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.30
PubTator Score 0.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.242 0.000
tuberculosis -1.200 0.000
active ulcerative colitis 1.327 0.021
psoriasis 2.500 0.000

AA Sequence

MMPLAEAGALAQGGGPSATEWACILRRKTPRHKQPTLLMVRASRRSGKTSAVLKAGRQSVSGRKNSTSKD      1 - 70
LVTLGASSLREERGHPLHPRHRKAVHLRTRGRTRGWVQTLARMSRRTRGPVERAAAAAAAAAGGDAGHAP     71 - 140
FPPPPAADGARAPRSPGQVTPRGLRLRLPRRESLLRGLCRPLRPLLGFRESDSAKPASLRLLQHTPSARR    141 - 210
NYRIAGARLMRSNYPPPLSSAALRGAGPTRRN                                          211 - 242
//

Text Mined References (4)

PMID Year Title
21757650 2011 Identification of cis- and trans-acting genetic variants explaining up to half the variation in circulating vascular endothelial growth factor levels.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.