Property Summary

NCBI Gene PubMed Count 18
Grant Count 2
Funding $440,056
PubMed Score 18.33
PubTator Score 16.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
hepatocellular carcinoma 1.100 0.001
psoriasis 1.100 0.006
osteosarcoma 2.211 0.000
intraductal papillary-mucinous neoplasm ... 1.700 0.027
lung cancer 1.100 0.001
ovarian cancer 1.900 0.000

Synonym

Accession Q8N302 O00581 Q53YS3 Q9BU84 Q9NW66
Symbols VG5Q
GPATC7
GPATCH7
HSU84971
HUS84971

Gene

 Grant Application (2)

 GO Function (1)

Gene RIF (12)

PMID Text
25796501 Overexpression of AGGF1 is correlated with angiogenesis in hepatocellular carcinoma.
24893993 AGGF1 reduces myocardial apoptosis and inflammation and enhances angiogenesis, leading to decreased infarct size after I/R injury.
24462738 results of this study indicate that hypoxia down-regulates expression of the AGGF1 protein, but not AGGF1 mRNA, by inducing expression of miR-27a
23628701 AGGF1 potently attenuated TNF-alpha triggered NF-kappaB pathway, as indicated by the decreased promoter activity, nuclear distribution and phosphorylation of NF-kappaB p65 subunit as well as the increased protein level of IkappaBalpha.
21576349 analysis of sphingolipid modulation of angiogenic factor expression in neuroblastoma
19556247 Knockdown of GATA1 expression by siRNA reduced expression of AGGF1, and resulted in endothelial cell apoptosis and inhibition of vessel formation.
18564129 identified two tagSNPs, rs13155212 and rs7704267 that capture information for all common variants in AGGF1 as a candidate susceptibility gene for Klippel-Trenaunay syndrome
18564129 Observational study of gene-disease association. (HuGE Navigator)
17103452 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
16911369 This review describes the somatic mutation for angiogenic factor VG5Q, which may be the cause of the multisystem disorder Klippel-Trenaunay syndrome.
More...

AA Sequence

MASEAPSPPRSPPPPTSPEPELAQLRRKVEKLERELRSCKRQVREIEKLLHHTERLYQNAESNNQELRTQ      1 - 70
VEELSKILQRGRNEDNKKSDVEVQTENHAPWSISDYFYQTYYNDVSLPNKVTELSDQQDQAIETSILNSK     71 - 140
DHLQVENDAYPGTDRTENVKYRQVDHFASNSQEPASALATEDTSLEGSSLAESLRAAAEAAVSQTGFSYD    141 - 210
ENTGLYFDHSTGFYYDSENQLYYDPSTGIYYYCDVESGRYQFHSRVDLQPYPTSSTKQSKDKKLKKKRKD    211 - 280
PDSSATNEEKDLNSEDQKAFSVEHTSCNEEENFANMKKKAKIGIHHKNSPPKVTVPTSGNTIESPLHENI    281 - 350
SNSTSFKDEKIMETDSEPEEGEITDSQTEDSYDEAITSEGNVTAEDSEDEDEDKIWPPCIRVIVIRSPVL    351 - 420
QIGSLFIITAVNPATIGREKDMEHTLRIPEVGVSKFHAEIYFDHDLQSYVLVDQGSQNGTIVNGKQILQP    421 - 490
KTKCDPYVLEHGDEVKIGETVLSFHIHPGSDTCDGCEPGQVRAHLRLDKKDESFVGPTLSKEEKELERRK    491 - 560
ELKKIRVKYGLQNTEYEDEKTLKNPKYKDRAGKRREQVGSEGTFQRDDAPASVHSEITDSNKGRKMLEKM    561 - 630
GWKKGEGLGKDGGGMKTPIQLQLRRTHAGLGTGKPSSFEDVHLLQNKNKKNWDKARERFTENFPETKPQK    631 - 700
DDPGTMPWVKGTLE                                                            701 - 714
//

Text Mined References (21)

PMID Year Title
25796501 2015 Overexpression of AGGF1 is correlated with angiogenesis and poor prognosis of hepatocellular carcinoma.
24893993 2014 AGGF1 protects from myocardial ischemia/reperfusion injury by regulating myocardial apoptosis and angiogenesis.
24462738 2014 Role of microRNA-27a in down-regulation of angiogenic factor AGGF1 under hypoxia associated with high-grade bladder urothelial carcinoma.
23628701 2013 AGGF1 is a novel anti-inflammatory factor associated with TNF-?-induced endothelial activation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21576349 2011 Sphingolipid modulation of angiogenic factor expression in neuroblastoma.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19556247 2009 Novel roles of GATA1 in regulation of angiogenic factor AGGF1 and endothelial cell function.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18564129 2008 Identification of association of common AGGF1 variants with susceptibility for Klippel-Trenaunay syndrome using the structure association program.
More...