Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.00
PubTator Score 0.67

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
oligodendroglioma -1.200 0.026
osteosarcoma -1.247 0.000
group 3 medulloblastoma 1.600 0.000
ovarian cancer 1.100 0.000

Gene RIF (2)

PMID Text
22614011 VASH2 contributes to the angiogenesis in hepatocellular carcinoma via an SVBP-mediated paracrine mechanism.
20736312 SVBP(CCDC23)acts as a secretory chaperone for VASH1.

AA Sequence

MDPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE          1 - 66
//

Text Mined References (7)

PMID Year Title
22614011 2013 Vasohibin 2 is transcriptionally activated and promotes angiogenesis in hepatocellular carcinoma.
20736312 2010 Isolation of a small vasohibin-binding protein (SVBP) and its role in vasohibin secretion.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.