Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.42
PubTator Score 0.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.0e-04
group 3 medulloblastoma 4104 2.9e-04
osteosarcoma 7950 4.3e-04
oligodendroglioma 2850 2.6e-02

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.600 2.9e-04
oligodendroglioma -1.200 2.6e-02
osteosarcoma -1.247 4.3e-04
ovarian cancer 1.100 1.0e-04

Synonym

Accession Q8N300 A8K5P1 D3DPW7
Symbols CCDC23

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (3)

AA Sequence

MDPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE          1 - 66
//

Text Mined References (8)

PMID Year Title