Property Summary

NCBI Gene PubMed Count 43
Grant Count 52
R01 Count 32
Funding $6,181,549.9
PubMed Score 87.81
PubTator Score 97.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -2.000 0.000
group 3 medulloblastoma -1.700 0.001
medulloblastoma, large-cell -3.200 0.001
colon cancer -1.200 0.000
interstitial cystitis -1.300 0.026
pilocytic astrocytoma 1.300 0.000
posterior fossa group A ependymoma -1.400 0.002
Breast cancer -1.200 0.033
lung carcinoma 3.100 0.000
ductal carcinoma in situ -1.300 0.001
invasive ductal carcinoma -1.700 0.000
ovarian cancer -1.400 0.000
pituitary cancer 1.800 0.000

Gene RIF (25)

PMID Text
26674772 NLGN1 was associated with schizophrenia in Chinese Han Populations
26440732 Neuroligin 1 (NL1) promotes the formation of glutamatergic synapses and mediates long-term potentiation.
26109803 Neuroligin-1 and Glu may represent new markers of ganglion cells, whose expression may correlate with the pathogenesis, diagnosis, differential diagnosis or classification of Hirschsprung's disease.
26078884 Results indicate that the neurexin and neuroligin synaptic complex is intrinsically involved in the regulation of DISC1 function, thus contributing to a better understanding of the pathology of schizophrenia.
25428619 the expression of NL1 and its binding partner neurexin-1beta was increased in temporal lobe epileptic foci in patients and lithium-pilocarpine-treated epileptic rats.
25399301 Increasing expression of TGF-beta1 protein, decreasing expressions of Ghrelin, Neurexin, and Neuroligin proteins can induce the loss or dysfunction of ganglion cells in distal intestinal canal
23929743 We identified a cluster of single nucleotide polymorphisms at the NLGN1 locus showing significant association with BP variability. Follow-up analyses did not support an association with risk of ischemic stroke and its subtypes
23853109 Monitoring the attachment and detachment of neurexin (Nrx)-coated quantum dots measures the rates of neurexin (Nrx)/neuroligin interaction in the hippocampus.
23719805 these manipulations of NL1 function illuminate the significance of NL1 intracellular signaling in vivo, and enhance our understanding of the factors that gate the maturation of glutamatergic synapses and complex behavior
23264101 Expression levels of neurexin and neuroligin in ENS are significantly down-regulated in HSCR, which may be involved in the pathogenesis of HSCR.
More...

AA Sequence

MALPRCTWPNYVWRAVMACLVHRGLGAPLTLCMLGCLLQAGHVLSQKLDDVDPLVATNFGKIRGIKKELN      1 - 70
NEILGPVIQFLGVPYAAPPTGERRFQPPEPPSPWSDIRNATQFAPVCPQNIIDGRLPEVMLPVWFTNNLD     71 - 140
VVSSYVQDQSEDCLYLNIYVPTEDGPLTKKRDEATLNPPDTDIRDSGGPKPVMVYIHGGSYMEGTGNLYD    141 - 210
GSVLASYGNVIVITVNYRLGVLGFLSTGDQAAKGNYGLLDLIQALRWTSENIGFFGGDPLRITVFGSGAG    211 - 280
GSCVNLLTLSHYSEGNRWSNSTKGLFQRAIAQSGTALSSWAVSFQPAKYARMLATKVGCNVSDTVELVEC    281 - 350
LQKKPYKELVDQDIQPARYHIAFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGVNQGEGLKFVENIVDSD    351 - 420
DGISASDFDFAVSNFVDNLYGYPEGKDVLRETIKFMYTDWADRHNPETRRKTLLALFTDHQWVAPAVATA    421 - 490
DLHSNFGSPTYFYAFYHHCQTDQVPAWADAAHGDEVPYVLGIPMIGPTELFPCNFSKNDVMLSAVVMTYW    491 - 560
TNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWTRYSQKDQLYLHIGLKPRVKEHYRANKVNLWLELVPHL    561 - 630
HNLNDISQYTSTTTKVPSTDITFRPTRKNSVPVTSAFPTAKQDDPKQQPSPFSVDQRDYSTELSVTIAVG    631 - 700
ASLLFLNILAFAALYYKKDKRRHDVHRRCSPQRTTTNDLTHAQEEEIMSLQMKHTDLDHECESIHPHEVV    701 - 770
LRTACPPDYTLAMRRSPDDVPLMTPNTITMIPNTIPGIQPLHTFNTFTGGQNNTLPHPHPHPHSHSTTRV    771 - 840
//

Text Mined References (45)

PMID Year Title
26674772 2015 Evidence for Association of Cell Adhesion Molecules Pathway and NLGN1 Polymorphisms with Schizophrenia in Chinese Han Population.
26440732 2015 A truncating mutation in Alzheimer's disease inactivates neuroligin-1 synaptic function.
26109803 2015 Abundance and significance of neuroligin-1 and glutamate in Hirschsprung's disease.
26078884 2015 Neurexin-Neuroligin Synaptic Complex Regulates Schizophrenia-Related DISC1/Kal-7/Rac1 "Signalosome".
25428619 2016 Neuroligin-1 Knockdown Suppresses Seizure Activity by Regulating Neuronal Hyperexcitability.
25399301 2015 TGF-?1, Ghrelin, Neurexin, and Neuroligin are predictive biomarkers for postoperative prognosis of laparoscopic surgery in children with Hirschsprung disease.
24613359 2014 Calsyntenins function as synaptogenic adhesion molecules in concert with neurexins.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23929743 2013 Genome-wide analysis of blood pressure variability and ischemic stroke.
23853109 2013 Assembly of synapses: biomimetic assays to control neurexin/neuroligin interactions at the neuronal surface.
More...