Property Summary

NCBI Gene PubMed Count 45
PubMed Score 95.14
PubTator Score 97.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Astrocytoma, Pilocytic 1.300 1.5e-05
Breast cancer -1.200 3.3e-02
colon cancer -1.200 3.8e-05
ductal carcinoma in situ -1.300 8.2e-04
group 3 medulloblastoma -1.700 1.0e-03
interstitial cystitis -1.300 2.6e-02
invasive ductal carcinoma -1.700 1.3e-04
lung carcinoma 3.100 2.4e-12
malignant mesothelioma -2.000 2.6e-05
medulloblastoma, large-cell -3.200 5.4e-04
ovarian cancer -1.300 1.2e-06
pituitary cancer 1.800 1.7e-07
posterior fossa group A ependymoma -1.400 1.7e-03

Gene RIF (27)

AA Sequence

MALPRCTWPNYVWRAVMACLVHRGLGAPLTLCMLGCLLQAGHVLSQKLDDVDPLVATNFGKIRGIKKELN      1 - 70
NEILGPVIQFLGVPYAAPPTGERRFQPPEPPSPWSDIRNATQFAPVCPQNIIDGRLPEVMLPVWFTNNLD     71 - 140
VVSSYVQDQSEDCLYLNIYVPTEDGPLTKKRDEATLNPPDTDIRDSGGPKPVMVYIHGGSYMEGTGNLYD    141 - 210
GSVLASYGNVIVITVNYRLGVLGFLSTGDQAAKGNYGLLDLIQALRWTSENIGFFGGDPLRITVFGSGAG    211 - 280
GSCVNLLTLSHYSEGNRWSNSTKGLFQRAIAQSGTALSSWAVSFQPAKYARMLATKVGCNVSDTVELVEC    281 - 350
LQKKPYKELVDQDIQPARYHIAFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGVNQGEGLKFVENIVDSD    351 - 420
DGISASDFDFAVSNFVDNLYGYPEGKDVLRETIKFMYTDWADRHNPETRRKTLLALFTDHQWVAPAVATA    421 - 490
DLHSNFGSPTYFYAFYHHCQTDQVPAWADAAHGDEVPYVLGIPMIGPTELFPCNFSKNDVMLSAVVMTYW    491 - 560
TNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWTRYSQKDQLYLHIGLKPRVKEHYRANKVNLWLELVPHL    561 - 630
HNLNDISQYTSTTTKVPSTDITFRPTRKNSVPVTSAFPTAKQDDPKQQPSPFSVDQRDYSTELSVTIAVG    631 - 700
ASLLFLNILAFAALYYKKDKRRHDVHRRCSPQRTTTNDLTHAQEEEIMSLQMKHTDLDHECESIHPHEVV    701 - 770
LRTACPPDYTLAMRRSPDDVPLMTPNTITMIPNTIPGIQPLHTFNTFTGGQNNTLPHPHPHPHSHSTTRV    771 - 840
//

Text Mined References (47)

PMID Year Title