Property Summary

NCBI Gene PubMed Count 11
Grant Count 3
Funding $318,901.3
PubMed Score 41.10
PubTator Score 27.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -3.000 0.000
oligodendroglioma 2.000 0.031
cutaneous lupus erythematosus 1.200 0.021
astrocytoma 1.400 0.000
glioblastoma 2.200 0.003
posterior fossa group B ependymoma 3.200 0.000
group 4 medulloblastoma -2.400 0.000
cystic fibrosis 1.329 0.000
non-small cell lung cancer 1.060 0.000
adult high grade glioma 1.400 0.002
pilocytic astrocytoma 2.400 0.000
lung adenocarcinoma 2.200 0.000
inflammatory breast cancer 1.200 0.024
lung carcinoma 1.800 0.000
ovarian cancer 2.600 0.000
pituitary cancer -1.100 0.027
psoriasis 3.200 0.000

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16413018 The PHTS is involved in HeLaHF reversion independently of the p53 pathway, and Expression profiling revealed that PHTS is one of the genes that is up-regulated in HeLaHF but not in HeLa.

AA Sequence

MWVLGIAATFCGLFLLPGFALQIQCYQCEEFQLNNDCSSPEFIVNCTVNVQDMCQKEVMEQSAGIMYRKS      1 - 70
CASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRGSSASALRPGLRTTILFLKLALFSAH     71 - 140
C//

Text Mined References (12)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16413018 2006 PHTS, a novel putative tumor suppressor, is involved in the transformation reversion of HeLaHF cells independently of the p53 pathway.
16368877 2006 Genomic annotation of 15,809 ESTs identified from pooled early gestation human eyes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...