Property Summary

NCBI Gene PubMed Count 11
PubMed Score 49.81
PubTator Score 27.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma 1.400 2.0e-03
astrocytoma 1.400 3.8e-10
Astrocytoma, Pilocytic 2.400 1.6e-11
cutaneous lupus erythematosus 1.200 2.1e-02
cystic fibrosis 1.329 4.8e-05
ependymoma 1.700 9.8e-04
glioblastoma 1.500 5.9e-04
group 4 medulloblastoma -2.400 2.5e-07
inflammatory breast cancer 1.200 2.4e-02
lung adenocarcinoma 2.200 5.9e-06
lung carcinoma 1.800 3.7e-17
malignant mesothelioma -3.000 4.5e-07
non-small cell lung cancer 1.060 2.1e-09
oligodendroglioma 2.000 3.1e-02
ovarian cancer 2.600 3.5e-04
pituitary cancer -1.100 2.7e-02
psoriasis 3.200 5.0e-82

Gene RIF (2)

AA Sequence

MWVLGIAATFCGLFLLPGFALQIQCYQCEEFQLNNDCSSPEFIVNCTVNVQDMCQKEVMEQSAGIMYRKS      1 - 70
CASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRGSSASALRPGLRTTILFLKLALFSAH     71 - 140
C//

Text Mined References (12)

PMID Year Title