Knowledge Summary

Patent

No data available

 Compartment GO Term (0)

AA Sequence

MGLLSQRKWTLSGSQQTGCVALTVPSFPWVASRMHYGRKQVSWIIFLKIGAGCQVHVGHDCSTLRRQQGA      1 - 70
PWSFASSFRPAASPLAPPSPGVSGLFPPHERWSGGSQTRCGKCVKMQILGSTLKLFRHPPSQVTRLWGRH     71 - 140
HLKTPAPFLQSPGIQLNPGKVPASLLRLATWKPL                                        141 - 174
//

Text Mined References (3)

PMID Year Title