Knowledge Summary

Patent

No data available

Synonym

Accession Q8N2B8 Q2NKN5
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MGLLSQRKWTLSGSQQTGCVALTVPSFPWVASRMHYGRKQVSWIIFLKIGAGCQVHVGHDCSTLRRQQGA      1 - 70
PWSFASSFRPAASPLAPPSPGVSGLFPPHERWSGGSQTRCGKCVKMQILGSTLKLFRHPPSQVTRLWGRH     71 - 140
HLKTPAPFLQSPGIQLNPGKVPASLLRLATWKPL                                        141 - 174
//

Text Mined References (3)

PMID Year Title
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.