Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.88
PubTator Score 1.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Situs ambiguus 25
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Hydrocephalus 152 3.606 1.8
Primary ciliary dyskinesia 76 3.57 1.8
Disease Target Count
Situs Inversus 65

Expression

  Differential Expression (8)

Disease log2 FC p
chronic rhinosinusitis -2.338 1.6e-02
Endometriosis -1.282 2.5e-02
ependymoma 3.200 2.2e-09
glioblastoma -1.300 9.1e-03
group 4 medulloblastoma -1.300 1.3e-04
lung adenocarcinoma -1.100 2.8e-03
medulloblastoma, large-cell -1.800 1.4e-04
nasopharyngeal carcinoma -3.400 1.4e-07

Gene RIF (1)

AA Sequence

MDNKISPEAQVAELELDAVIGFNGHVPTGLKCHPDQEHMIYPLGCTVLIQAINTKEQNFLQGHGNNVSCL      1 - 70
AISRSGEYIASGQVTFMGFKADIILWDYKNRELLARLSLHKGKIEALAFSPNDLYLVSLGGPDDGSVVVW     71 - 140
SIAKRDAICGSPAAGLNVGNATNVIFSRCRDEMFMTAGNGTIRVWELDLPNRKIWPTECQTGQLKRIVMS    141 - 210
IGVDDDDSFFYLGTTTGDILKMNPRTKLLTDVGPAKDKFSLGVSAIRCLKMGGLLVGSGAGLLVFCKSPG    211 - 280
YKPIKKIQLQGGITSITLRGEGHQFLVGTEESHIYRVSFTDFKETLIATCHFDAVEDIVFPFGTAELFAT    281 - 350
CAKKDIRVWHTSSNRELLRITVPNMTCHGIDFMRDGKSIISAWNDGKIRAFAPETGRLMYVINNAHRIGV    351 - 420
TAIATTSDCKRVISGGGEGEVRVWQIGCQTQKLEEALKEHKSSVSCIRVKRNNEECVTASTDGTCIIWDL    421 - 490
VRLRRNQMILANTLFQCVCYHPEEFQIITSGTDRKIAYWEVFDGTVIRELEGSLSGSINGMDITQEGVHF    491 - 560
VTGGNDHLVKVWDYNEGEVTHVGVGHSGNITRIRISPGNQYIVSVSADGAILRWKYPYTS              561 - 620
//

Text Mined References (7)

PMID Year Title