Property Summary

NCBI Gene PubMed Count 32
PubMed Score 45.82
PubTator Score 36.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (24)

Disease log2 FC p
Breast cancer -1.100 4.7e-05
active Crohn's disease 2.050 2.1e-02
active ulcerative colitis 1.725 1.2e-02
atypical teratoid / rhabdoid tumor -3.600 2.3e-06
cystic fibrosis 4.000 4.9e-07
ependymoma -2.000 1.6e-07
gastric carcinoma 1.700 3.1e-02
Gaucher disease type 3 -1.100 2.2e-02
glioblastoma -1.900 1.3e-04
intraductal papillary-mucinous adenoma (... -1.700 1.2e-02
intraductal papillary-mucinous carcinoma... -1.300 3.4e-02
invasive ductal carcinoma 1.108 1.6e-02
lung adenocarcinoma -1.200 3.5e-10
lung cancer -1.900 2.3e-04
malignant mesothelioma -2.600 2.0e-08
medulloblastoma, large-cell -3.100 6.0e-07
nasopharyngeal carcinoma 1.400 8.7e-04
non-small cell lung cancer -2.196 6.5e-26
osteosarcoma 1.821 3.7e-03
ovarian cancer -3.400 1.5e-08
pediatric high grade glioma -1.300 1.5e-03
primitive neuroectodermal tumor -1.400 1.0e-03
psoriasis -1.500 7.0e-08
tuberculosis -3.700 1.4e-07

Protein-protein Interaction (3)

Gene RIF (17)

AA Sequence

MWIPTEHEKYGVVIASFRGTVPYGLSLEIGDTVQILEKCDGWYRGFALKNPNIKGIFPSSYVHLKNACVK      1 - 70
NKGQFEMVIPTEDSVITEMTSTLRDWGTMWKQLYVRNEGDLFHRLWHIMNEILDLRRQVLVGHLTHDRMK     71 - 140
DVKRHITARLDWGNEQLGLDLVPRKEYAMVDPEDISITELYRLMEHRHRKKDTPVQASSHHLFVQMKSLM    141 - 210
CSNLGEELEVIFSLFDSKENRPISERFFLRLNRNGLPKAPDKPERHCSLFVDLGSSELRKDIYITVHIIR    211 - 280
IGRMGAGEKKNACSVQYRRPFGCAVLSIADLLTGETKDDLILKVYMCNTESEWYQIHENIIKKLNARYNL    281 - 350
TGSNAGLAVSLQLLHGDIEQIRREYSSVFSHGVSITRKLGFSNIIMPGEMRNDLYITIERGEFEKGGKSV    351 - 420
ARNVEVTMFIVDSSGQTLKDFISFGSGEPPASEYHSFVLYHNNSPRWSELLKLPIPVDKFRGAHIRFEFR    421 - 490
HCSTKEKGEKKLFGFSFVPLMQEDGRTLPDGTHELIVHKCEENTNLQDTTRYLKLPFSKGIFLGNNNQAM    491 - 560
KATKESFCITSFLCSTKLTQNGDMLDLLKWRTHPDKITGCLSKLKEIDGSEIVKFLQDTLDTLFGILDEN    561 - 630
SQKYGSKVFDSLVHIINLLQDSKFHHFKPVMDTYIESHFAGALAYRDLIKVLKWYVDRITEAERQEHIQE    631 - 700
VLKAQEYIFKYIVQSRRLFSLATGGQNEEEFRCCIQELLMSVRFFLSQESKGSGALSQSQAVFLSSFPAV    701 - 770
YSELLKLFDVREVANLVQDTLGSLPTILHVDDSLQAIKLQCIGKTVESQLYTNPDSRYILLPVVLHHLHI    771 - 840
HLQEQKDLIMCARILSNVFCLIKKNSSEKSVLEEIDVIVASLLDILLRTILEITSRPQPSSSAMRFQFQD    841 - 910
VTGEFVACLLSLLRQMTDRHYQQLLDSFNTKEELRDFLLQIFTVFRILIRPEMFPKDWTVMRLVANNVII    911 - 980
TTVLYLSDALRKNFLNENFDYKIWDSYFYLAVIFINQLCLQLEMFTPSKKKKVLEKYGDMRVTMGCEIFS    981 - 1050
MWQNLGEHKLHFIPALIGPFLEVTLIPQPDLRNVMIPIFHDMMDWEQRRSGNFKQVEAKLIDKLDSLMSE   1051 - 1120
GKGDETYRELFNSILLKKIERETWRESGVSLIATVTRLMERLLDYRDCMKMGEVDGKKIGCTVSLLNFYK   1121 - 1190
TELNKEEMYIRYIHKLYDLHLKAQNFTEAAYTLLLYDELLEWSDRPLREFLTYPMQTEWQRKEHLHLTII   1191 - 1260
QNFDRGKCWENGIILCRKIAEQYESYYDYRNLSKMRMMEASLYDKIMDQQRLEPEFFRVGFYGKKFPFFL   1261 - 1330
RNKEFVCRGHDYERLEAFQQRMLNEFPHAIAMQHANQPDETIFQAEAQYLQIYAVTPIPESQEVLQREGV   1331 - 1400
PDNIKSFYKVNHIWKFRYDRPFHKGTKDKENEFKSLWVERTSLYLVQSLPGISRWFEVEKREVVEMSPLE   1401 - 1470
NAIEVLENKNQQLKTLISQCQTRQMQNINPLTMCLNGVIDAAVNGGVSRYQEAFFVKEYILSHPEDGEKI   1471 - 1540
ARLRELMLEQAQILEFGLAVHEKFVPQDMRPLHKKLVDQFFVMKSSLGIQEFSACMQASPVHFPNGSPRV   1541 - 1610
CRNSAPASVSPDGTRVIPRRSPLSYPAVNRYSSSSLSSQASAEVSNITGQSESSDEVFNMQPSPSTSSLS   1611 - 1680
STHSASPNVTSSAPSSARASPLLSDKHKHSRENSCLSPRERPCSAIYPTPVEPSQRMLFNHIGDGALPRS   1681 - 1750
DPNLSAPEKAVNPTPSSWSLDSGKEAKNMSDSGKLISPPVPPRPTQTASPARHTTSVSPSPAGRSPLKGS   1751 - 1820
VQSFTPSPVEYHSPGLISNSPVLSGSYSSGISSLSRCSTSETSGFENQVNEQSAPLPVPVPVPVPSYGGE   1821 - 1890
EPVRKESKTPPPYSVYERTLRRPVPLPHSLSIPVTSEPPALPPKPLAARSSHLENGARRTDPGPRPRPLP   1891 - 1960
RKVSQL                                                                   1961 - 1966
//

Text Mined References (35)

PMID Year Title