Property Summary

NCBI Gene PubMed Count 21
PubMed Score 22.16
PubTator Score 9.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -2.100 3.4e-06
astrocytic glioma -1.700 4.3e-03
Astrocytoma, Pilocytic -2.600 1.1e-10
atypical teratoid / rhabdoid tumor 1.300 1.6e-02
ependymoma -1.800 7.8e-03
glioblastoma -2.300 5.2e-12
group 3 medulloblastoma 2.600 5.6e-07
lung cancer 1.200 4.5e-03
medulloblastoma, large-cell 1.400 2.8e-04
non primary Sjogren syndrome sicca -1.100 2.8e-02
oligodendroglioma -1.500 9.6e-03
ovarian cancer 1.300 2.8e-05
Pick disease -1.300 6.4e-03
primitive neuroectodermal tumor 1.400 4.0e-04

 GWAS Trait (1)

Gene RIF (4)

AA Sequence

MDTEGFGELLQQAEQLAAETEGISELPHVERNLQEIQQAGERLRSRTLTRTSQETADVKASVLLGSRGLD      1 - 70
ISHISQRLESLSAATTFEPLEPVKDTDIQGFLKNEKDNALLSAIEESRKRTFGMAEEYHRESMLVEWEQV     71 - 140
KQRILHTLLASGEDALDFTQESEPSYISDVGPPGRSSLDNIEMAYARQIYIYNEKIVNGHLQPNLVDLCA    141 - 210
SVAELDDKSISDMWTMVKQMTDVLLTPATDALKNRSSVEVRMEFVRQALAYLEQSYKNYTLVTVFGNLHQ    211 - 280
AQLGGVPGTYQLVRSFLNIKLPAPLPGLQDGEVEGHPVWALIYYCMRCGDLLAASQVVNRAQHQLGEFKT    281 - 350
WFQEYMNSKDRRLSPATENKLRLHYRRALRNNTDPYKRAVYCIIGRCDVTDNQSEVADKTEDYLWLKLNQ    351 - 420
VCFDDDGTSSPQDRLTLSQFQKQLLEDYGESHFTVNQQPFLYFQVLFLTAQFEAAVAFLFRMERLRCHAV    421 - 490
HVALVLFELKLLLKSSGQSAQLLSHEPGDPPCLRRLNFVRLLMLYTRKFESTDPREALQYFYFLRDEKDS    491 - 560
QGENMFLRCVSELVIESREFDMILGKLENDGSRKPGVIDKFTSDTKPIINKVASVAENKGLFEEAAKLYD    561 - 630
LAKNADKVLELMNKLLSPVVPQISAPQSNKERLKNMALSIAERYRAQGISANKFVDSTFYLLLDLITFFD    631 - 700
EYHSGHIDRAFDIIERLKLVPLNQESVEERVAAFRNFSDEIRHNLSEVLLATMNILFTQFKRLKGTSPSS    701 - 770
SSRPQRVIEDRDSQLRSQARTLITFAGMIPYRTSGDTNARLVQMEVLMN                         771 - 819
//

Text Mined References (31)

PMID Year Title