Property Summary

NCBI Gene PubMed Count 20
Grant Count 6
Funding $112,003.47
PubMed Score 21.99
PubTator Score 9.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.700 0.004
ependymoma -2.700 0.000
oligodendroglioma -1.500 0.010
glioblastoma -2.300 0.000
group 3 medulloblastoma 2.600 0.000
atypical teratoid/rhabdoid tumor -2.200 0.000
medulloblastoma, large-cell -1.700 0.000
primitive neuroectodermal tumor 1.400 0.000
lung cancer 1.200 0.004
pediatric high grade glioma -2.300 0.000
pilocytic astrocytoma -2.600 0.000
non primary Sjogren syndrome sicca -1.100 0.028
Pick disease -1.300 0.006
ovarian cancer 1.300 0.000

Synonym

Accession Q8N1F7 B3KPQ8 Q14705
Symbols NIC96
NPHS12

Gene

PANTHER Protein Class (1)

PDB

5IJN   5IJO  

Gene RIF (3)

PMID Text
26878725 NUP93 and exportin 5 interact with the signaling protein SMAD4 and that NUP93 mutations abrogated interaction with SMAD4
19454010 Interaction of HIV-1 Tat with Nup93 in T-cells is identified by a proteomic strategy based on affinity chromatography
16286466 Caspases target only Nup93 and Nup96 within the core structure of the nuclear pore complex

AA Sequence

MDTEGFGELLQQAEQLAAETEGISELPHVERNLQEIQQAGERLRSRTLTRTSQETADVKASVLLGSRGLD      1 - 70
ISHISQRLESLSAATTFEPLEPVKDTDIQGFLKNEKDNALLSAIEESRKRTFGMAEEYHRESMLVEWEQV     71 - 140
KQRILHTLLASGEDALDFTQESEPSYISDVGPPGRSSLDNIEMAYARQIYIYNEKIVNGHLQPNLVDLCA    141 - 210
SVAELDDKSISDMWTMVKQMTDVLLTPATDALKNRSSVEVRMEFVRQALAYLEQSYKNYTLVTVFGNLHQ    211 - 280
AQLGGVPGTYQLVRSFLNIKLPAPLPGLQDGEVEGHPVWALIYYCMRCGDLLAASQVVNRAQHQLGEFKT    281 - 350
WFQEYMNSKDRRLSPATENKLRLHYRRALRNNTDPYKRAVYCIIGRCDVTDNQSEVADKTEDYLWLKLNQ    351 - 420
VCFDDDGTSSPQDRLTLSQFQKQLLEDYGESHFTVNQQPFLYFQVLFLTAQFEAAVAFLFRMERLRCHAV    421 - 490
HVALVLFELKLLLKSSGQSAQLLSHEPGDPPCLRRLNFVRLLMLYTRKFESTDPREALQYFYFLRDEKDS    491 - 560
QGENMFLRCVSELVIESREFDMILGKLENDGSRKPGVIDKFTSDTKPIINKVASVAENKGLFEEAAKLYD    561 - 630
LAKNADKVLELMNKLLSPVVPQISAPQSNKERLKNMALSIAERYRAQGISANKFVDSTFYLLLDLITFFD    631 - 700
EYHSGHIDRAFDIIERLKLVPLNQESVEERVAAFRNFSDEIRHNLSEVLLATMNILFTQFKRLKGTSPSS    701 - 770
SSRPQRVIEDRDSQLRSQARTLITFAGMIPYRTSGDTNARLVQMEVLMN                         771 - 819
//

Text Mined References (30)

PMID Year Title
26878725 2016 Mutations in nuclear pore genes NUP93, NUP205 and XPO5 cause steroid-resistant nephrotic syndrome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22780124 2013 Genome-wide association study of a quantitative disordered gambling trait.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21150319 2010 Proteomic profiling of Myc-associated proteins.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20031564 2009 Polymorphism in the CETP gene region, HDL cholesterol, and risk of future myocardial infarction: Genomewide analysis among 18 245 initially healthy women from the Women's Genome Health Study.
More...