Property Summary

NCBI Gene PubMed Count 25
PubMed Score 245.73
PubTator Score 75.20

Knowledge Summary

Patent

No data available

Expression

Gene RIF (20)

AA Sequence

MATALMAVVLRAAAVAPRLRGRGGTGGARRLSCGARRRAARGTSPGRRLSTAWSQPQPPPEEYAGADDVS      1 - 70
QSPVAEEPSWVPSPRPPVPHESPEPPSGRSLVQRDIQAFLNQCGASPGEARHWLTQFQTCHHSADKPFAV     71 - 140
IEVDEEVLKCQQGVSSLAFALAFLQRMDMKPLVVLGLPAPTAPSGCLSFWEAKAQLAKSCKVLVDALRHN    141 - 210
AAAAVPFFGGGSVLRAAEPAPHASYGGIVSVETDLLQWCLESGSIPILCPIGETAARRSVLLDSLEVTAS    211 - 280
LAKALRPTKIIFLNNTGGLRDSSHKVLSNVNLPADLDLVCNAEWVSTKERQQMRLIVDVLSRLPHHSSAV    281 - 350
ITAASTLLTELFSNKGSGTLFKNAERMLRVRSLDKLDQGRLVDLVNASFGKKLRDDYLASLRPRLHSIYV    351 - 420
SEGYNAAAILTMEPVLGGTPYLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSD    421 - 490
GSFSNKQWIFFWFGLADIRDSYELVNHAKGLPDSFHKPASDPGS                              491 - 534
//

Text Mined References (25)

PMID Year Title