Property Summary

NCBI Gene PubMed Count 23
Grant Count 12
R01 Count 5
Funding $773,698.67
PubMed Score 23.42
PubTator Score 9.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma -1.508 0.021
adult high grade glioma -1.200 0.000
non primary Sjogren syndrome sicca 1.300 0.010
ovarian cancer -1.400 0.000
pancreatic cancer -1.400 0.004

Gene RIF (13)

PMID Text
26083938 cytoplasmic centrobin has roles in noncentrosomal microtubule formation in specific cell types and during the cell cycle
25616662 Centrobin plays a role in the stability and centriole elongation function of CPAP and limits the centriole length.
24700465 Centrobin-CPAP interaction is critical for the recruitment of CPAP to procentrioles to promote the elongation of daughter centrioles and for the persistence of CPAP on preexisting mother centrioles.
23442802 it is proposed that Centrobin might regulate microtubule nucleation and organization by controlling the amount of pericentriolar matrix
23291182 NEK2 phosphorylation antagonizes the microtubule stabilizing activity of centrobin.
23001753 Our results indicate that genetic polymorphisms of centrobin and Nek2 are related to breast cancer susceptibility in Chinese Han women.
21576394 Centrobin facilitates the elongation and stability of centrioles via its interaction with tubulins.
20511645 Data propose that centrobin functions as a microtubule stabilizing factor and PLK1 enhances centrobin activity for proper spindle formation during mitosis.
20508983 Observational study of gene-disease association. (HuGE Navigator)
20190801 a requirement of Centrobin in maintaining centrosome integrity, which in turn promotes anchoring of mitotic spindle to the centrosomes.
More...

AA Sequence

MATSADSPSSPLGAEDLLSDSSEPPGLNQVSSEVTSQLYASLRLSRQAEATARAQLYLPSTSPPHEGLDG      1 - 70
FAQELSRSLSVGLEKNLKKKDGSKHIFEMESVRGQLQTMLQTSRDTAYRDPLIPGAGSERREEDSFDSDS     71 - 140
TATLLNTRPLQDLSPSSSAQALEELFPRYTSLRPGPPLNPPDFQGLRDALDSEHTRRKHCERHIQSLQTR    141 - 210
VLELQQQLAVAVAADRKKDTMIEQLDKTLARVVEGWNRHEAERTEVLRGLQEEHQAAELTRSKQQETVTR    211 - 280
LEQSLSEAMEALNREQESARLQQRERETLEEERQALTLRLEAEQQRCCVLQEERDAARAGQLSEHRELET    281 - 350
LRAALEEERQTWAQQEHQLKEHYQALQEESQAQLEREKEKSQREAQAAWETQHQLALVQSEVRRLEGELD    351 - 420
TARRERDALQLEMSLVQARYESQRIQLESELAVQLEQRVTERLAQAQESSLRQAASLREHHRKQLQDLSG    421 - 490
QHQQELASQLAQFKVEMAEREERQQQVAEDYELRLAREQARVCELQSGNQQLEEQRVELVERLQAMLQAH    491 - 560
WDEANQLLSTTLPPPNPPAPPAGPSSPGPQEPEKEERRVWTMPPMAVALKPVLQQSREARDELPGAPPVL    561 - 630
CSSSSDLSLLLGPSFQSQHSFQPLEPKPDLTSSTAGAFSALGAFHPDHRAERPFPEEDPGPDGEGLLKQG    631 - 700
LPPAQLEGLKNFLHQLLETVPQNNENPSVDLLPPKSGPLTVPSWEEAPQVPRIPPPVHKTKVPLAMASSL    701 - 770
FRVPEPPSSHSQGSGPSSGSPERGGDGLTFPRQLMEVSQLLRLYQARGWGALPAEDLLLYLKRLEHSGTD    771 - 840
GRGDNVPRRNTDSRLGEIPRKEIPSQAVPRRLATAPKTEKPPARKKSGHPAPSSMRSRGGVWR           841 - 903
//

Text Mined References (27)

PMID Year Title
26083938 2015 The microtubule nucleation activity of centrobin in both the centrosome and cytoplasm.
25616662 2015 Centrobin-mediated regulation of the centrosomal protein 4.1-associated protein (CPAP) level limits centriole length during elongation stage.
25416956 2014 A proteome-scale map of the human interactome network.
24700465 2014 Centrobin-centrosomal protein 4.1-associated protein (CPAP) interaction promotes CPAP localization to the centrioles during centriole duplication.
23442802 2013 Centrobin regulates centrosome function in interphase cells by limiting pericentriolar matrix recruitment.
23291182 2013 NEK2 phosphorylation antagonizes the microtubule stabilizing activity of centrobin.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23001753 2012 Genetic polymorphisms in centrobin and Nek2 are associated with breast cancer susceptibility in a Chinese Han population.
21576394 2011 Centrobin-tubulin interaction is required for centriole elongation and stability.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
More...