Property Summary

NCBI Gene PubMed Count 10
Grant Count 12
R01 Count 12
Funding $1,013,102.91
PubMed Score 7.46
PubTator Score 6.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.400 0.003
oligodendroglioma -1.100 0.012
glioblastoma -1.900 0.000
group 4 medulloblastoma -2.100 0.000
atypical teratoid / rhabdoid tumor -2.100 0.000
medulloblastoma, large-cell -2.400 0.000
primitive neuroectodermal tumor -1.700 0.000
breast carcinoma -1.500 0.000
fibroadenoma -1.500 0.010
Breast cancer -2.300 0.035
adult high grade glioma -1.800 0.000

Gene RIF (7)

PMID Text
24662834 Intratumoral heterogeneity of ADAM23 promotes tumor growth and metastasis through LGI4 and nitric oxide signals.
20220021 Schwann cells are the principal cellular source of Lgi4 in the developing nerve; transgenic Lgi4 binds directly to Adam22 without a requirement for additional membrane associated factors.
19815358 The positive genotypic association between benign familial infantile convulsions (BFIC)and c.1722G/A polymorphism suggests that LGI4 might contribute to the susceptibility to BFIC.
19815358 Observational study of gene-disease association. (HuGE Navigator)
14505228 Observational study of gene-disease association. (HuGE Navigator)
14505228 Screening of the LGI4 coding region in BFIC and childhood absence epilepsy (CAE) revealed several frequent exonic polymorphisms.
12217514 has seven copies of the EPTP repeat, a unifying protein sequence motif of a heterogenous group of proteins linked to epileptic diseases. The EPTP repeat probably forms a beta-propeller structure.

AA Sequence

MGGAGILLLLLAGAGVVVAWRPPKGKCPLRCSCSKDSALCEGSPDLPVSFSPTLLSLSLVRTGVTQLKAG      1 - 70
SFLRIPSLHLLLFTSNSFSVIEDDAFAGLSHLQYLFIEDNEIGSISKNALRGLRSLTHLSLANNHLETLP     71 - 140
RFLFRGLDTLTHVDLRGNPFQCDCRVLWLLQWMPTVNASVGTGACAGPASLSHMQLHHLDPKTFKCRAIE    141 - 210
LSWFQTVGESALSVEPFSYQGEPHIVLAQPFAGRCLILSWDYSLQRFRPEEELPAASVVSCKPLVLGPSL    211 - 280
FVLAARLWGGSQLWARPSPGLRLAPTQTLAPRRLLRPNDAELLWLEGQPCFVVADASKAGSTTLLCRDGP    281 - 350
GFYPHQSLHAWHRDTDAEALELDGRPHLLLASASQRPVLFHWTGGRFERRTDIPEAEDVYATRHFQAGGD    351 - 420
VFLCLTRYIGDSMVMRWDGSMFRLLQQLPSRGAHVFQPLLIARDQLAILGSDFAFSQVLRLEPDKGLLEP    421 - 490
LQELGPPALVAPRAFAHITMAGRRFLFAACFKGPTQIYQHHEIDLSA                           491 - 537
//

Text Mined References (11)

PMID Year Title
24662834 2015 Intratumoral heterogeneity of ADAM23 promotes tumor growth and metastasis through LGI4 and nitric oxide signals.
20220021 2010 Adam22 is a major neuronal receptor for Lgi4-mediated Schwann cell signaling.
19815358 2010 Positive association between benign familial infantile convulsions and LGI4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14505228 2004 Genotypic association of exonic LGI4 polymorphisms and childhood absence epilepsy.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12217514 2002 The novel EPTP repeat defines a superfamily of proteins implicated in epileptic disorders.
12095917 2002 A common protein interaction domain links two recently identified epilepsy genes.
12023020 2002 The LGI1 gene involved in lateral temporal lobe epilepsy belongs to a new subfamily of leucine-rich repeat proteins.
More...