Property Summary

NCBI Gene PubMed Count 27
PubMed Score 24.78
PubTator Score 15.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -2.300 6.3e-04
atypical teratoid / rhabdoid tumor -1.600 3.2e-08
cutaneous lupus erythematosus -1.100 1.7e-02
cystic fibrosis 2.200 1.4e-03
glioblastoma -1.200 3.3e-05
malignant mesothelioma -2.300 9.0e-07
medulloblastoma -1.500 4.0e-02
medulloblastoma, large-cell -2.800 1.1e-05
osteosarcoma 1.003 2.7e-04
pituitary cancer 1.400 2.5e-04
primary pancreatic ductal adenocarcinoma -1.019 3.2e-03
primitive neuroectodermal tumor -1.900 7.2e-03
psoriasis -2.200 1.7e-04

 MGI Phenotype (1)

 CSPA Cell Line (3)

Protein-protein Interaction (1)

Gene RIF (14)

AA Sequence

MGAPAASLLLLLLLFACCWAPGGANLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTL      1 - 70
YFGEKRALRDNRIQLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKS     71 - 140
SLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCS    141 - 210
VNHESLKGADRSTSQRIEVLYTPTAMIRPDPPHPREGQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQ    211 - 280
ESALIFPFLNKSDSGTYGCTATSNMGSYKAYYTLNVNDPSPVPSSSSTYHAIIGGIVAFIVFLLLIMLIF    281 - 350
LGHYLIRHKGTYLTHEAKGSDDAPDADTAIINAEGGQSGGDDKKEYFI                          351 - 398
//

Text Mined References (27)

PMID Year Title