Property Summary

NCBI Gene PubMed Count 27
Grant Count 10
R01 Count 10
Funding $710,951.6
PubMed Score 23.63
PubTator Score 15.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Gene RIF (14)

PMID Text
24112238 Nectin-based cell-cell adhesion was formed at the apical side of the junctional adhesion molecule (JAM)-based cell-cell adhesion; cadherin and claudin were recruited to the nectin-3 and JAM-based cell-cell adhesion sites to form AJ- and TJ-like domains.
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
21325282 Findings clearly reveal the structural basis for the cis-dimerization of nectins through the first Ig-like domains.
20598232 A link might exist between NECL1 and the extracellular matrix protein OPN in inhibiting the migration and invasion of U251 glioma ce
20237496 Observational study of gene-disease association. (HuGE Navigator)
20078932 NECL1 can inhibit the migration and invasion of glioma cells and induce differentiation.
19565570 Nec- 1 suppress the growth and tumorigenic ability of colon cancer cells.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
19062177 suggests that NECL1 may act as a tumor suppressor in glioma and loss of it in glioma may be caused by histone deacetylation
18686605 NECL1 may inhibit the proliferation of T98G cells by inducing its apoptosis.
More...

AA Sequence

MGAPAASLLLLLLLFACCWAPGGANLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTL      1 - 70
YFGEKRALRDNRIQLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKS     71 - 140
SLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCS    141 - 210
VNHESLKGADRSTSQRIEVLYTPTAMIRPDPPHPREGQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQ    211 - 280
ESALIFPFLNKSDSGTYGCTATSNMGSYKAYYTLNVNDPSPVPSSSSTYHAIIGGIVAFIVFLLLIMLIF    281 - 350
LGHYLIRHKGTYLTHEAKGSDDAPDADTAIINAEGGQSGGDDKKEYFI                          351 - 398
//

Text Mined References (27)

PMID Year Title
24112238 2013 Nectin and junctional adhesion molecule are critical cell adhesion molecules for the apico-basal alignment of adherens and tight junctions in epithelial cells.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
22291609 2012 A genome-wide association scan on the levels of markers of inflammation in Sardinians reveals associations that underpin its complex regulation.
21325282 2011 Crystal Structure of the cis-Dimer of Nectin-1: implications for the architecture of cell-cell junctions.
20598232 2010 Nectin-like molecule 1 inhibits the migration and invasion of U251 glioma cells by regulating the expression of an extracellular matrix protein osteopontin.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20078932 2009 [Neural adhesion molecule NECL1 inhibits migration, invasion, and potentially induces differentiation of glioma cell].
19565570 2009 The cell adhesion nectin-like molecules (Necl) 1 and 4 suppress the growth and tumorigenic ability of colon cancer cells.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
19062177 2009 Loss of NECL1, a novel tumor suppressor, can be restored in glioma by HDAC inhibitor-Trichostatin A through Sp1 binding site.
More...