Property Summary

NCBI Gene PubMed Count 25
PubMed Score 165.62
PubTator Score 52.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy 1.101 4.9e-05
intraductal papillary-mucinous adenoma (... 1.400 1.9e-04
juvenile dermatomyositis 1.156 1.8e-10
medulloblastoma, large-cell 1.100 7.6e-06
spina bifida -1.210 4.6e-02
tuberculosis 1.300 4.8e-03
ulcerative colitis -1.100 1.1e-07

Gene RIF (10)

AA Sequence

MAEPSVESSSPGGSATSDDHEFDPSADMLVHDFDDERTLEEEEMMEGETNFSSEIEDLAREGDMPIHELL      1 - 70
SLYGYGSTVRLPEEDEEEEEEEEEGEDDEDADNDDNSGCSGENKEENIKDSSGQEDETQSSNDDPSQSVA     71 - 140
SQDAQEIIRPRRCKYFDTNSEVEEESEEDEDYIPSEDWKKEIMVGSMFQAEIPVGICRYKENEKVYENDD    141 - 210
QLLWDPEYLPEDKVIIFLKDASRRTGDEKGVEAIPEGSHIKDNEQALYELVKCNFDTEEALRRLRFNVKA    211 - 280
AREELSVWTEEECRNFEQGLKAYGKDFHLIQANKVRTRSVGECVAFYYMWKKSERYDFFAQQTRFGKKKY    281 - 350
NLHPGVTDYMDRLLDESESAASSRAPSPPPTASNSSNSQSEKEDGTVSTANQNGVSSNGPGEILNKEEVK    351 - 420
VEGLHINGPTGGNKKPLHADMDTNGYETDNLTTDPKLAHMTARNENDFDEKSERPAKRRRVNSNGKESPG    421 - 490
SSEFFQEAVSHGKFEELENTDD                                                    491 - 512
//

Text Mined References (36)

PMID Year Title