Property Summary

NCBI Gene PubMed Count 24
Grant Count 277
R01 Count 212
Funding $21,781,640.59
PubMed Score 158.56
PubTator Score 52.40

Knowledge Summary

Patent

No data available

Expression

Gene

Gene RIF (9)

PMID Text
26938916 Biochemical analysis of the BAHD1-associated multiprotein complex identifies MIER proteins as novel partners of BAHD1 and suggests that BAHD1-MIER interaction forms a hub for histone deacetylases and methyltransferases
26281834 Insulin and IGF-1 alter the subcellular localization of MIER1alpha in breast carcinoma cells.
24376786 nuclear targeting of MIER1alpha requires an intact ELM2 domain and is dependent on interaction with HDAC1/2
23277184 the first immunohistochemical study of the MIER1alpha protein expression pattern in human tissues, is reported.
22384264 Differential splicing alters subcellular localization of the alpha but not beta isoform of the MIER1 transcriptional regulator in breast cancer cells
18665173 Loss of nuclear MI-ER1 alpha might contribute to the development of invasive breast carcinoma
15117948 the association of hMI-ER1 with Sp1 represents a novel mechanism for the negative regulation of Sp1 target promoters
12482978 we investigated the role of hMI-ER1alpha and hMI-ER1beta in the regulation of transcription.We demonstrate that this repressor activity is due to interaction and recruitment of a trichostatin A-sensitive histone deacetylase 1 (HDAC1).
12242014 Results demonstrate that alternate use of a facultative intron regulates the subcellular localization of hMI-ER1 proteins and this may have important implications for hMI-ER1 function.

AA Sequence

MAEPSVESSSPGGSATSDDHEFDPSADMLVHDFDDERTLEEEEMMEGETNFSSEIEDLAREGDMPIHELL      1 - 70
SLYGYGSTVRLPEEDEEEEEEEEEGEDDEDADNDDNSGCSGENKEENIKDSSGQEDETQSSNDDPSQSVA     71 - 140
SQDAQEIIRPRRCKYFDTNSEVEEESEEDEDYIPSEDWKKEIMVGSMFQAEIPVGICRYKENEKVYENDD    141 - 210
QLLWDPEYLPEDKVIIFLKDASRRTGDEKGVEAIPEGSHIKDNEQALYELVKCNFDTEEALRRLRFNVKA    211 - 280
AREELSVWTEEECRNFEQGLKAYGKDFHLIQANKVRTRSVGECVAFYYMWKKSERYDFFAQQTRFGKKKY    281 - 350
NLHPGVTDYMDRLLDESESAASSRAPSPPPTASNSSNSQSEKEDGTVSTANQNGVSSNGPGEILNKEEVK    351 - 420
VEGLHINGPTGGNKKPLHADMDTNGYETDNLTTDPKLAHMTARNENDFDEKSERPAKRRRVNSNGKESPG    421 - 490
SSEFFQEAVSHGKFEELENTDD                                                    491 - 512
//

Text Mined References (34)

PMID Year Title
26938916 2016 Role of the BAHD1 Chromatin-Repressive Complex in Placental Development and Regulation of Steroid Metabolism.
26281834 2015 Insulin and IGF-1, but not 17?-estradiol, alter the subcellular localization of MIER1? in MCF7 breast carcinoma cells.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24376786 2013 Nuclear localization of the transcriptional regulator MIER1? requires interaction with HDAC1/2 in breast cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23752268 2013 The functional interactome landscape of the human histone deacetylase family.
23277184 2013 Protein expression pattern of human MIER1 alpha, a novel estrogen receptor binding protein.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22384264 2012 Differential splicing alters subcellular localization of the alpha but not beta isoform of the MIER1 transcriptional regulator in breast cancer cells.
More...