Property Summary

NCBI Gene PubMed Count 16
PubMed Score 90.18
PubTator Score 61.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (2)

Gene RIF (6)

AA Sequence

MAPGEKESGEGPAKSALRKIRTATLVISLARGWQQWANENSIRQAQEPTGWLPGGTQDSPQAPKPITPPT      1 - 70
SHQKAQSAPKSPPRLPEGHGDGQSSEKAPEVSHIKKKEVSKTVVSKTYERGGDVSHLSHRYERDAGVLEP     71 - 140
GQPENDIDRILHSHGSPTRRRKCANLVSELTKGWRVMEQEEPTWRSDSVDTEDSGYGGEAEERPEQDGVQ    141 - 210
VAVVRIKRPLPSQVNRFTEKLNCKAQQKYSPVGNLKGRWQQWADEHIQSQKLNPFSEEFDYELAMSTRLH    211 - 280
KGDEGYGRPKEGTKTAERAKRAEEHIYREMMDMCFIICTMARHRRDGKIQVTFGDLFDRYVRISDKVVGI    281 - 350
LMRARKHGLVDFEGEMLWQGRDDHVVITLLK                                           351 - 381
//

Text Mined References (17)

PMID Year Title