Property Summary

NCBI Gene PubMed Count 15
Grant Count 19
R01 Count 6
Funding $1,642,447.81
PubMed Score 87.05
PubTator Score 61.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
23753523 These results show that resistance exercise provides an acute stimulation of the STARS pathway that is contraction mode dependent.
21486805 STARS signalling pathway is upregulated in response to acute endurance exercise and suggest suggest a novel role co-ordination of PGC-1alpha-induced upregulation of the fat oxidative gene, CPT-1beta.
19255118 STARS signalling pathway is responsive to changes in skeletal muscle loading and appears to play a role in both human skeletal muscle hypertrophy and atrophy
17415416 Modulates the responsiveness of the heart to stress signaling by functioning as a cytoskeletal intermediary between human and transgenic myocyte enhancer factor-2 and serum response factor.
15798203 STARS activates serum response factor by inducing the nuclear translocation of myocardin-related transcription factors .

AA Sequence

MAPGEKESGEGPAKSALRKIRTATLVISLARGWQQWANENSIRQAQEPTGWLPGGTQDSPQAPKPITPPT      1 - 70
SHQKAQSAPKSPPRLPEGHGDGQSSEKAPEVSHIKKKEVSKTVVSKTYERGGDVSHLSHRYERDAGVLEP     71 - 140
GQPENDIDRILHSHGSPTRRRKCANLVSELTKGWRVMEQEEPTWRSDSVDTEDSGYGGEAEERPEQDGVQ    141 - 210
VAVVRIKRPLPSQVNRFTEKLNCKAQQKYSPVGNLKGRWQQWADEHIQSQKLNPFSEEFDYELAMSTRLH    211 - 280
KGDEGYGRPKEGTKTAERAKRAEEHIYREMMDMCFIICTMARHRRDGKIQVTFGDLFDRYVRISDKVVGI    281 - 350
LMRARKHGLVDFEGEMLWQGRDDHVVITLLK                                           351 - 381
//

Text Mined References (16)

PMID Year Title
23753523 2013 Effect of resistance exercise contraction mode and protein supplementation on members of the STARS signalling pathway.
23259602 2012 Genome-wide association scan of dental caries in the permanent dentition.
21486805 2011 Striated muscle activator of Rho signalling (STARS) is a PGC-1?/oestrogen-related receptor-? target gene and is upregulated in human skeletal muscle after endurance exercise.
19255118 2009 Regulation of STARS and its downstream targets suggest a novel pathway involved in human skeletal muscle hypertrophy and atrophy.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17415416 2007 Modulation of adverse cardiac remodeling by STARS, a mediator of MEF2 signaling and SRF activity.
16381901 2006 The LIFEdb database in 2006.
15798203 2005 Muscle-specific signaling mechanism that links actin dynamics to serum response factor.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...