Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.63
PubTator Score 6.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.060 0.000
lung cancer 1.200 0.002
lung carcinoma 1.400 0.000
mucosa-associated lymphoid tissue lympho... 1.065 0.047

Gene RIF (2)

PMID Text
20863412 The similarity of LGI2 share a common molecular disease mechanism causing genotypically distinct but phenotypically related forms of epilepsy.
20183877 protein sequence analysis and patient-specific chromosomal deletions are provided for LGI2 as the prime candidate gene for partial epilepsy with pericentral spikes among the 52 genes known at locus 4p15

AA Sequence

MALRRGGCGALGLLLLLLGAACLIPRSAQVRRLARCPATCSCTKESIICVGSSWVPRIVPGDISSLSLVN      1 - 70
GTFSEIKDRMFSHLPSLQLLLLNSNSFTIIRDDAFAGLFHLEYLFIEGNKIETISRNAFRGLRDLTHLSL     71 - 140
ANNHIKALPRDVFSDLDSLIELDLRGNKFECDCKAKWLYLWLKMTNSTVSDVLCIGPPEYQEKKLNDVTS    141 - 210
FDYECTTTDFVVHQTLPYQSVSVDTFNSKNDVYVAIAQPSMENCMVLEWDHIEMNFRSYDNITGQSIVGC    211 - 280
KAILIDDQVFVVVAQLFGGSHIYKYDESWTKFVKFQDIEVSRISKPNDIELFQIDDETFFVIADSSKAGL    281 - 350
STVYKWNSKGFYSYQSLHEWFRDTDAEFVDIDGKSHLILSSRSQVPIILQWNKSSKKFVPHGDIPNMEDV    351 - 420
LAVKSFRMQNTLYLSLTRFIGDSRVMRWNSKQFVEIQALPSRGAMTLQPFSFKDNHYLALGSDYTFSQIY    421 - 490
QWDKEKQLFKKFKEIYVQAPRSFTAVSTDRRDFFFASSFKGKTKIFEHIIVDLSL                   491 - 545
//

Text Mined References (13)

PMID Year Title
20863412 2010 Similarity of molecular phenotype between known epilepsy gene LGI1 and disease candidate gene LGI2.
20183877 2010 Is LGI2 the candidate gene for partial epilepsy with pericentral spikes?
16021519 2005 A two-dimensional electrophoresis reference map of human ovary.
16014869 2005 Using gene-history and expression analyses to assess the involvement of LGI genes in human disorders.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12217514 2002 The novel EPTP repeat defines a superfamily of proteins implicated in epileptic disorders.
12095917 2002 A common protein interaction domain links two recently identified epilepsy genes.
12023020 2002 The LGI1 gene involved in lateral temporal lobe epilepsy belongs to a new subfamily of leucine-rich repeat proteins.
More...