Property Summary

NCBI Gene PubMed Count 6
PubMed Score 10.44
PubTator Score 2.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung cancer 4740 5.7e-05

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer 1.600 5.7e-05

AA Sequence

MWAAAGGLWRSRAGLRALFRSRDAALFPGCERGLHCSAVSCKNWLKKFASKTKKKVWYESPSLGSHSTYK      1 - 70
PSKLEFLMRSTSKKTRKEDHARLRALNGLLYKALTDLLCTPEVSQELYDLNVELSKVSLTPDFSACRAYW     71 - 140
KTTLSAEQNAHMEAVLQRSAAHMRHLLMSQQTLRNVPPIVFVQDKGNAALAELDQLLAVADFGPRDERDN    141 - 210
FVQNDFRDPDAPQPCGTTEPTTSSSLCGIDHEALNKQIMEYKRRKDKGLGGLVWQGQVAELTTQMKKGRK    211 - 280
RAKPRLEQDSSLKSYLSGEEVEDDLDLVGAPEYECYAPDTEELEAERGGGRTEDGHSCGASRE           281 - 343
//

Text Mined References (7)

PMID Year Title