Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.17
PubTator Score 0.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 2.8e-35
osteosarcoma 7950 3.5e-04
inflammatory breast cancer 286 2.6e-02
non primary Sjogren syndrome sicca 891 3.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 1.0

Expression

  Differential Expression (4)

Disease log2 FC p
inflammatory breast cancer -1.400 2.6e-02
non primary Sjogren syndrome sicca 1.100 3.9e-02
osteosarcoma 1.148 3.5e-04
psoriasis -1.600 2.8e-35

AA Sequence

MALPQMCDGSHLASTLRYCMTVSGTVVLVAGTLCFAWWSEGDATAQPGQLAPPTEYPVPEGPSPLLRSVS      1 - 70
FVCCGAGGLLLLIGLLWSVKASIPGPPRWDPYHLSRDLYYLTVESSEKESCRTPKVVDIPTYEEAVSFPV     71 - 140
AEGPPTPPAYPTEEALEPSGSRDALLSTQPAWPPPSYESISLALDAVSAETTPSATRSCSGLVQTARGGS    141 - 210
//

Text Mined References (4)

PMID Year Title