Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 7.3e-04
diabetes mellitus -1.100 1.9e-02
ependymoma 1.100 5.6e-06
group 3 medulloblastoma 1.700 9.7e-05
hereditary spastic paraplegia -1.345 1.3e-02
pediatric high grade glioma 1.100 5.7e-05
primitive neuroectodermal tumor 1.700 2.2e-03

AA Sequence

MAKNKLRGPKSRNVFHIASQKNFKAKNKAKPVTTNLKKINIMNEEKVNRVNKAFVNVQKELAHFAKSISL      1 - 70
EPLQKELIPQQRHESKPVNVDEATRLMALL                                             71 - 100
//

Text Mined References (11)

PMID Year Title