Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.73
PubTator Score 2.81

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8N0S6 Q5TEL5 Q96ND4 CENP-L
Symbols CENP-L
C1orf155
dJ383J4.3

Gene

Gene RIF (1)

PMID Text
26698661 Study demonstrate that the CENP-L-N complex plays a crucial role at the core of the 16-subunit Constitutive Centromere-Associated Network through interactions with CENP-C and CENP-H-I-KM.

AA Sequence

MDSYSAPESTPSASSRPEDYFIGATPLQKRLESVRKQSSFILTPPRRKIPQCSQLQEDVDPQKVAFLLHK      1 - 70
QWTLYSLTPLYKFSYSNLKEYSRLLNAFIVAEKQKGLAVEVGEDFNIKVIFSTLLGMKGTQRDPEAFLVQ     71 - 140
IVSKSQLPSENREGKVLWTGWFCCVFGDSLLETVSEDFTCLPLFLANGAESNTAIIGTWFQKTFDCYFSP    141 - 210
LAINAFNLSWMAAMWTACKMDHYVATTEFLWSVPCSPQSLDISFAIHPEDAKALWDSVHKTPGEVTQEEV    211 - 280
DLFMDCLYSHFHRHFKIHLSATRLVRVSTSVASAHTDGKIKILCHKYLIGVLAYLTELAIFQIE          281 - 344
//

Text Mined References (14)

PMID Year Title
26698661 2015 The CENP-L-N Complex Forms a Critical Node in an Integrated Meshwork of Interactions at the Centromere-Kinetochore Interface.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16716197 2006 Comprehensive analysis of the ICEN (Interphase Centromere Complex) components enriched in the CENP-A chromatin of human cells.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16622420 2006 The CENP-H-I complex is required for the efficient incorporation of newly synthesized CENP-A into centromeres.
16622419 2006 The human CENP-A centromeric nucleosome-associated complex.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...