Property Summary

NCBI Gene PubMed Count 5
Grant Count 86
R01 Count 24
Funding $9,901,546.08
PubMed Score 135.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Synonym

Accession Q8MH63
Symbols DC49
MLAS
LAT1-3TM
hLAT1-3TM

Gene

AA Sequence

MAGAGPKRRALAAPVAEEKEEAREKMLASKRADGAAPAGEGEGVTLQRNITLLNGVAIIVGAIIGSGIFV      1 - 70
TPTGVLKEAGSPGLALVMWAACGVFSIVGALCYAELGTTISKSGGDYAYMLDVYGSLPAFLKLWIELLVI     71 - 140
RPSSQYIVALVFATYLLKPLFPSCPVPEEAAKLMACHCVH                                  141 - 180
//

Text Mined References (5)

PMID Year Title
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12009310 2002 Up-regulated expression of a novel gene in activated human peripheral blood mononuclear cells that is a truncated paralog of the human system L-amino acid transporter 1.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.