Property Summary

NCBI Gene PubMed Count 5
PubMed Score 156.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 1.5e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Cancer 2499 4.12 2.1
Lysinuric protein intolerance 15 3.888 1.9

Synonym

Accession Q8MH63
Symbols DC49
MLAS
LAT1-3TM
hLAT1-3TM

Gene

AA Sequence

MAGAGPKRRALAAPVAEEKEEAREKMLASKRADGAAPAGEGEGVTLQRNITLLNGVAIIVGAIIGSGIFV      1 - 70
TPTGVLKEAGSPGLALVMWAACGVFSIVGALCYAELGTTISKSGGDYAYMLDVYGSLPAFLKLWIELLVI     71 - 140
RPSSQYIVALVFATYLLKPLFPSCPVPEEAAKLMACHCVH                                  141 - 180
//

Text Mined References (5)

PMID Year Title