Property Summary

NCBI Gene PubMed Count 15
Grant Count 1,338
R01 Count 348
Funding $673,338,694.4
PubMed Score 1074.60
PubTator Score 26.57

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8J025 B4DUQ0 B4DZT0 Q71M25
Symbols HHS
HTS
B7323
HYPT1
DRAPC1
FP7019

Gene

Gene RIF (7)

PMID Text
25946682 This study demonstrated a critical role for Apcdd1 in OL differentiation after white matter injury that points to a potential therapeutic approach for inhibiting Wnt signaling in these disorders.
25592970 Unusual role of APCDD1 in dental follicle cells during osteogenic differentiation. APCDD1 sustains the expression and activation of beta-catenin.
22512811 mutation in the APCDD1 gene is responsible for hereditary hypotrichosis simplex in a large Chinese family.
21152411 Data show that the methylated VAPA-APCDD1 DNA in maternal plasma is predominantly derived from the fetus, and this novel fetal epigenetic marker in maternal plasma is useful for the noninvasive detection of fetal trisomy 18.
20393562 APCDD1 is a novel inhibitor of the Wnt signalling pathway with an essential role in human hair growth
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20200978 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSWPRRLLLRYLFPALLLHGLGEGSALLHPDSRSHPRSLEKSAWRAFKESQCHHMLKHLHNGARITVQMP      1 - 70
PTIEGHWVSTGCEVRSGPEFITRSYRFYHNNTFKAYQFYYGSNRCTNPTYTLIIRGKIRLRQASWIIRGG     71 - 140
TEADYQLHNVQVICHTEAVAEKLGQQVNRTCPGFLADGGPWVQDVAYDLWREENGCECTKAVNFAMHELQ    141 - 210
LIRVEKQYLHHNLDHLVEELFLGDIHTDATQRMFYRPSSYQPPLQNAKNHDHACIACRIIYRSDEHHPPI    211 - 280
LPPKADLTIGLHGEWVSQRCEVRPEVLFLTRHFIFHDNNNTWEGHYYHYSDPVCKHPTFSIYARGRYSRG    281 - 350
VLSSRVMGGTEFVFKVNHMKVTPMDAATASLLNVFNGNECGAEGSWQVGIQQDVTHTNGCVALGIKLPHT    351 - 420
EYEIFKMEQDARGRYLLFNGQRPSDGSSPDRPEKRATSYQMPLVQCASSSPRAEDLAEDSGSSLYGRAPG    421 - 490
RHTWSLLLAALACLVPLLHWNIRR                                                  491 - 514
//

Text Mined References (16)

PMID Year Title
25946682 2015 Apcdd1 stimulates oligodendrocyte differentiation after white matter injury.
25592970 2015 The WNT inhibitor APCDD1 sustains the expression of ?-catenin during the osteogenic differentiation of human dental follicle cells.
23999434 2013 Common genetic variation at the IL1RL1 locus regulates IL-33/ST2 signaling.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
22512811 2012 A recurrent mutation in the APCDD1 gene responsible for hereditary hypotrichosis simplex in a large Chinese family.
21866343 2012 The 18p11.22 locus is associated with never smoker non-small cell lung cancer susceptibility in Korean populations.
21152411 2010 Systematic identification of placental epigenetic signatures for the noninvasive prenatal detection of Edwards syndrome.
20393562 2010 APCDD1 is a novel Wnt inhibitor mutated in hereditary hypotrichosis simplex.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20200978 2010 Replication of previous genome-wide association studies of bone mineral density in premenopausal American women.
More...