Property Summary

NCBI Gene PubMed Count 17
PubMed Score 10.65
PubTator Score 26.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active Crohn's disease 1.798 1.6e-02
Astrocytoma, Pilocytic 1.500 2.6e-07
Breast cancer -2.700 2.8e-22
breast carcinoma -2.200 6.1e-07
ductal carcinoma in situ -2.000 1.3e-05
ependymoma 1.600 2.2e-09
head and neck cancer -1.200 7.1e-03
interstitial cystitis -1.300 5.4e-03
intraductal papillary-mucinous adenoma (... -1.800 9.2e-04
intraductal papillary-mucinous carcinoma... -1.500 1.0e-02
intraductal papillary-mucinous neoplasm ... -2.100 3.9e-03
invasive ductal carcinoma -3.600 2.5e-04
lung adenocarcinoma -1.700 1.7e-08
oligodendroglioma 1.300 3.1e-02
ovarian cancer 1.700 2.2e-03
pancreatic cancer 1.300 5.1e-03
primary pancreatic ductal adenocarcinoma 1.674 1.1e-02

Gene RIF (9)

AA Sequence

MSWPRRLLLRYLFPALLLHGLGEGSALLHPDSRSHPRSLEKSAWRAFKESQCHHMLKHLHNGARITVQMP      1 - 70
PTIEGHWVSTGCEVRSGPEFITRSYRFYHNNTFKAYQFYYGSNRCTNPTYTLIIRGKIRLRQASWIIRGG     71 - 140
TEADYQLHNVQVICHTEAVAEKLGQQVNRTCPGFLADGGPWVQDVAYDLWREENGCECTKAVNFAMHELQ    141 - 210
LIRVEKQYLHHNLDHLVEELFLGDIHTDATQRMFYRPSSYQPPLQNAKNHDHACIACRIIYRSDEHHPPI    211 - 280
LPPKADLTIGLHGEWVSQRCEVRPEVLFLTRHFIFHDNNNTWEGHYYHYSDPVCKHPTFSIYARGRYSRG    281 - 350
VLSSRVMGGTEFVFKVNHMKVTPMDAATASLLNVFNGNECGAEGSWQVGIQQDVTHTNGCVALGIKLPHT    351 - 420
EYEIFKMEQDARGRYLLFNGQRPSDGSSPDRPEKRATSYQMPLVQCASSSPRAEDLAEDSGSSLYGRAPG    421 - 490
RHTWSLLLAALACLVPLLHWNIRR                                                  491 - 514
//

Text Mined References (18)

PMID Year Title