Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.77
PubTator Score 7.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Melanoma 711 0.0 0.0
Disease Target Count P-value
psoriasis 6694 6.4e-24
ependymoma 4679 9.1e-09
urothelial carcinoma 318 5.0e-05
interstitial cystitis 2312 4.4e-04
group 4 medulloblastoma 1855 1.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Hereditary spherocytosis type 3 14 4.835 2.4
Microcephaly 166 3.091 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma -1.100 9.1e-09
group 4 medulloblastoma -1.100 1.3e-03
interstitial cystitis -1.500 4.4e-04
psoriasis -2.600 6.4e-24
urothelial carcinoma -1.800 5.0e-05

Gene RIF (4)

AA Sequence

MLFKQQAWLRQKLLVLGSLAVGSLLYLVARVGSLDRLQPICPIEGRLGGARTQAEFPLRALQFKRGLLHE      1 - 70
FRKGNASKEQVRLHDLVQQLPKAIIIGVRKGGTRALLEMLNLHPAVVKASQEIHFFDNDENYGKGIEWYR     71 - 140
KKMPFSYPQQITIEKSPAYFITEEVPERIYKMNSSIKLLIIVREPTTRAISDYTQVLEGKERKNKTYYKF    141 - 210
EKLAIDPNTCEVNTKYKAVRTSIYTKHLERWLKYFPIEQFHVVDGDRLITEPLPELQLVEKFLNLPPRIS    211 - 280
QYNLYFNATRGFYCLRFNIIFNKCLAGSKGRIHPEVDPSVITKLRKFFHPFNQKFYQITGRTLNWP        281 - 346
//

Text Mined References (11)

PMID Year Title