Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.72
PubTator Score 0.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Keratoconus 113 3.83 1.9

Expression

Synonym

Accession Q8IZP6 Q8WWF9 Q96QY9
Symbols RNF161
ZNF183L1
bA10G5.1

Gene

PDB

2CSY  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MAAPPSPGRTADQADQVCTFLFKKPGRKGAAGLRKRPACDPEHGESSSSGDEGDTVAQPPRVAPRPRGLH      1 - 70
SWQKAAHGDRRGEEAAPESLDVVYRSTRSAKPVGPEDMGATADFEQDTEKEHHTPTILKCSQRVQEALRG     71 - 140
REHDHIYRGIHSYLRYLKPKDTSMGNSSSGMARKGPIRAPGHLRATVRWDYQPDICKDYKETGFCGFGDS    141 - 210
CKFLHDRSDYKLGWEIERELEEGRYCICEDENHEVGSEEEEIPFRCFICRQAFQNPVVTKCRHYFCESCA    211 - 280
LEHFRATPRCYICDQPTGGIFNPAKELMAKLQKLQAAEGKKR                                281 - 322
//

Text Mined References (4)

PMID Year Title