Property Summary

NCBI Gene PubMed Count 66
Grant Count 215
R01 Count 127
Funding $19,205,941.45
PubMed Score 75.38
PubTator Score 73.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.500 0.000
ependymoma -1.300 0.032
osteosarcoma -1.201 0.001
atypical teratoid / rhabdoid tumor -1.300 0.000
glioblastoma -1.400 0.010
group 4 medulloblastoma -1.300 0.000
medulloblastoma, large-cell -1.400 0.000
pediatric high grade glioma -1.100 0.007

Synonym

Accession Q8IZL8 O15450 Q5EGN3 Q6NTE6 Q96FT1 Q9BU60
Symbols MNAR
P160

Gene

Gene RIF (50)

PMID Text
27045366 three techniques for the first time demonstrated the presence of the PELP1 in paraspinal muscles of patients with idiopathic scoliosis.
26825173 PELP1 interacted with GR to activate Brk expression.
26472563 we propose that PELP1/Ki-67 double high expression in tumors is an independent prognostic factor for predicting a poor outcome for patients with Triple-negative breast cancer
26428280 The diffuse and strong nuclear immunoreactivity of PELP1 in most cases suggests that PELP1 may be a molecular target for the treatment of triple-negative breast carcinoma
26211588 There are significantly higher amounts of PELP1 transcript and protein in tumor tissues in patients with non-small cell lung cancer.
26158753 There is mounting evidence that PELP1 plays key roles in several biological processes and its deregulation leads to the development of cancers.
25788226 Results show that PELP1 is highly phosphorylated in triple negative breast cancer cells and interacts with mutated Tp53 and E2F1 to differentially regulates their target gene expression.
24967003 PELP1 exhibits an oncogenic function in colorectal cancer through c-Src upregulation.
24859989 This review focuses on the interactive functions and therapeutic and prognostic significance of PELP1 in breast and prostate cancers.
24786831 The PELP1 interacts with p53, functions as p53-coactivator and is required for optimal activation of p53 target genes under genomic stress.
More...

AA Sequence

MAAAVLSGPSAGSAAGVPGGTGGLSAVSSGPRLRLLLLESVSGLLQPRTGSAVAPVHPPNRSAPHLPGLM      1 - 70
CLLRLHGSVGGAQNLSALGALVSLSNARLSSIKTRFEGLCLLSLLVGESPTELFQQHCVSWLRSIQQVLQ     71 - 140
TQDPPATMELAVAVLRDLLRYAAQLPALFRDISMNHLPGLLTSLLGLRPECEQSALEGMKACMTYFPRAC    141 - 210
GSLKGKLASFFLSRVDALSPQLQQLACECYSRLPSLGAGFSQGLKHTESWEQELHSLLASLHTLLGALYE    211 - 280
GAETAPVQNEGPGVEMLLSSEDGDAHVLLQLRQRFSGLARCLGLMLSSEFGAPVSVPVQEILDFICRTLS    281 - 350
VSSKNISLHGDGPLRLLLLPSIHLEALDLLSALILACGSRLLRFGILIGRLLPQVLNSWSIGRDSLSPGQ    351 - 420
ERPYSTVRTKVYAILELWVQVCGASAGMLQGGASGEALLTHLLSDISPPADALKLRSPRGSPDGSLQTGK    421 - 490
PSAPKKLKLDVGEAMAPPSHRKGDSNANSDVCAAALRGLSRTILMCGPLIKEETHRRLHDLVLPLVMGVQ    491 - 560
QGEVLGSSPYTSSRCRRELYCLLLALLLAPSPRCPPPLACALQAFSLGQREDSLEVSSFCSEALVTCAAL    561 - 630
THPRVPPLQPMGPTCPTPAPVPPPEAPSPFRAPPFHPPGPMPSVGSMPSAGPMPSAGPMPSAGPVPSARP    631 - 700
GPPTTANHLGLSVPGLVSVPPRLLPGPENHRAGSNEDPILAPSGTPPPTIPPDETFGGRVPRPAFVHYDK    701 - 770
EEASDVEISLESDSDDSVVIVPEGLPPLPPPPPSGATPPPIAPTGPPTASPPVPAKEEPEELPAAPGPLP    771 - 840
PPPPPPPPVPGPVTLPPPQLVPEGTPGGGGPPALEEDLTVININSSDEEEEEEEEEEEEEEEEEEEEEDF    841 - 910
EEEEEDEEEYFEEEEEEEEEFEEEFEEEEGELEEEEEEEDEEEEEELEEVEDLEFGTAGGEVEEGAPPPP    911 - 980
TLPPALPPPESPPKVQPEPEPEPGLLLEVEEPGTEEERGADTAPTLAPEALPSQGEVEREGESPAAGPPP    981 - 1050
QELVEEEPSAPPTLLEEETEDGSDKVQPPPETPAEEEMETETEAEALQEKEQDDTAAMLADFIDCPPDDE   1051 - 1120
KPPPPTEPDS                                                               1121 - 1130
//

Text Mined References (78)

PMID Year Title
27045366 2016 Expression of Estrogen Receptor Coactivator Proline-, Glutamic Acid- and Leucine-Rich Protein 1 within Paraspinal Muscles in Adolescents with Idiopathic Scoliosis.
26825173 2016 Breast Tumor Kinase (Brk/PTK6) Is Induced by HIF, Glucocorticoid Receptor, and PELP1-Mediated Stress Signaling in Triple-Negative Breast Cancer.
26472563 2015 Prognostic significance of proline, glutamic acid, leucine rich protein 1 (PELP1) in triple-negative breast cancer: a retrospective study on 129 cases.
26428280 2015 Significantly increased PELP1 protein expression in primary and metastatic triple-negative breast carcinoma: comparison with GATA3 expression and PELP1's potential role in triple-negative breast carcinoma.
26211588 2015 Increased expression of proline-, glutamic acid- and leucine-rich protein PELP1 in non-small cell lung cancer.
26158753 2015 Minireview: Deciphering the Cellular Functions of PELP1.
25788226 2015 Novel role of PELP1 in regulating chemotherapy response in mutant p53-expressing triple negative breast cancer cells.
24967003 2014 PELP1 suppression inhibits colorectal cancer through c-Src downregulation.
24859989 2014 The social network of PELP1 and its implications in breast and prostate cancers.
24786831 2014 Proline, glutamic acid and leucine-rich protein-1 is essential for optimal p53-mediated DNA damage response.
More...