Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.47
PubTator Score 1.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
lung adenocarcinoma 2,713
osteosarcoma 7,933

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -5.095 0.000
lung adenocarcinoma -1.200 0.000

Gene RIF (1)

PMID Text
12140761 Human rgr: transforming activity and alteration in T-cell malignancies [rgr: ralGDS-related]

AA Sequence

MRKLLTNLPAAAVLSAQVYSAVLQGLWEENVCGTPGRTRVCTALLYGQVCPFQDSTDGLRTITSILFNWP      1 - 70
PENTSVYYQPPQRSSFRIKLAFRNLSWPGLGLEDHQEIVLGQLVLPEPNEAKPDDPAPRPGQHALTMPAL     71 - 140
EPAPPLLADLGPALEPESPAALGPPGYLHSAPGPAPAPGEGPPPGTVLEPQSAPESSCPCRGSVKNQPSE    141 - 210
ELPDMTTFPPRLLAEQLTLMDAELFKKVVLHECLGCIWGQGHLKGNEHMAPTVRATIAHFNRLTNCITTS    211 - 280
CLGDHSMRARDRARVVEHWIKVARECLSLNNFSSVHVIVSALCSNPIGQLHKTWAGVSSKSMKELKELCK    281 - 350
KDTAVKRDLLIKAGSFKVATQERNPQRVQMRLRRQKKGVVPFLGDFLTELQRLDSAIPDDLDGNTNKRSK    351 - 420
EVRVLQEMQLLQVAAMNYRLRPLEKFVTYFTRMEQLSDKESYKLSCQLEPENP                     421 - 473
//

Text Mined References (7)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12874025 2003 rgr oncogene: activation by elimination of translational controls and mislocalization.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12140761 2002 Human rgr: transforming activity and alteration in T-cell malignancies.
10851075 2000 The Rgr oncogene (homologous to RalGDS) induces transformation and gene expression by activating Ras, Ral and Rho mediated pathways.
10591208 1999 The DNA sequence of human chromosome 22.
9178890 1997 rsc: a novel oncogene with structural and functional homology with the gene family of exchange factors for Ral.