Property Summary

NCBI Gene PubMed Count 31
Grant Count 29
R01 Count 23
Funding $2,355,245.29
PubMed Score 114.20
PubTator Score 38.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -2.728 0.000
group 4 medulloblastoma 1.200 0.000
juvenile dermatomyositis 1.708 0.000
acute quadriplegic myopathy 1.534 0.000
tuberculosis and treatment for 3 months -1.600 0.000
spina bifida -1.692 0.045

Gene RIF (9)

PMID Text
25855736 Occupation of each miR-122 binding site on 5' untranslated region of the hepatitis C virus genome contributes equally and cooperatively to virus replication via protecting from Xrn1 exoribonuclease degradation.
25797256 Data show that the AR-miR-204-XRN1-miR-34a positive feedback loop and a dual function of miR-204/XRN1 axis in prostate cancer.
25766294 Thus, Xrn1 is a cellular factor regulating dsRNA accumulation and dsRNA-responsive innate immune effectors.
25673723 Authors conclude that Xrn1 is the dominant 5' exoribonuclease mediating decay of hepatitis C virus RNA and that miR-122 provides protection against it
25631074 Cellular biotinylated 5'-3' exoribonuclease 1 protein (XRN1) is incorporated into HIV-1 Gag virus-like particles
23248316 Data show that 5' exonuclease Xrn1 knockdown and miR-122 supplementation have equal, redundant, and nonadditive effects on the rate of viral RNA decay, indicating that miR-122 protects HCV RNA from 5' decay.
23142987 findings reveal a role for XRN1 in decapping and provide a molecular basis for the coupling of decapping to 5'-->3' mRNA degrada
12515382 LSm1-7 proteins colocalize with DCP1,DCP2 and Xrn1 in cytoplasmic foci
9049243 Mouse Xrn1 plays a role in RNA turnover.

AA Sequence

MGVPKFYRWISERYPCLSEVVKEHQIPEFDNLYLDMNGIIHQCSHPNDDDVHFRISDDKIFTDIFHYLEV      1 - 70
LFRIIKPRKVFFMAVDGVAPRAKMNQQRGRRFRSAKEAEDKIKKAIEKGETLPTEARFDSNCITPGTEFM     71 - 140
ARLHEHLKYFVNMKISTDKSWQGVTIYFSGHETPGEGEHKIMEFIRSEKAKPDHDPNTRHCLYGLDADLI    141 - 210
MLGLTSHEAHFSLLREEVRFGGKKTQRVCAPEETTFHLLHLSLMREYIDYEFSVLKEKITFKYDIERIID    211 - 280
DWILMGFLVGNDFIPHLPHLHINHDALPLLYGTYVTILPELGGYINESGHLNLPRFEKYLVKLSDFDREH    281 - 350
FSEVFVDLKWFESKVGNKYLNEAAGVAAEEARNYKEKKKLKGQENSLCWTALDKNEGEMITSKDNLEDET    351 - 420
EDDDLFETEFRQYKRTYYMTKMGVDVVSDDFLADQAACYVQAIQWILHYYYHGVQSWSWYYPYHYAPFLS    421 - 490
DIHNISTLKIHFELGKPFKPFEQLLAVLPAASKNLLPACYQHLMTNEDSPIIEYYPPDFKTDLNGKQQEW    491 - 560
EAVVLIPFIDEKRLLEAMETCNHSLKKEERKRNQHSECLMCWYDRDTEFIYPSPWPEKFPAIERCCTRYK    561 - 630
IISLDAWRVDINKNKITRIDQKALYFCGFPTLKHIRHKFFLKKSGVQVFQQSSRGENMMLEILVDAESDE    631 - 700
LTVENVASSVLGKSVFVNWPHLEEARVVAVSDGETKFYLEEPPGTQKLYSGRTAPPSKVVHLGDKEQSNW    701 - 770
AKEVQGISEHYLRRKGIIINETSAVVYAQLLTGRKYQINQNGEVRLEKQWSKQVVPFVYQTIVKDIRAFD    771 - 840
SRFSNIKTLDDLFPLRSMVFMLGTPYYGCTGEVQDSGDVITEGRIRVIFSIPCEPNLDALIQNQHKYSIK    841 - 910
YNPGYVLASRLGVSGYLVSRFTGSIFIGRGSRRNPHGDHKANVGLNLKFNKKNEEVPGYTKKVGSEWMYS    911 - 980
SAAEQLLAEYLERAPELFSYIAKNSQEDVFYEDDIWPGENENGAEKVQEIITWLKGHPVSTLSRSSCDLQ    981 - 1050
ILDAAIVEKIEEEVEKCKQRKNNKKVRVTVKPHLLYRPLEQQHGVIPDRDAEFCLFDRVVNVRENFSVPV   1051 - 1120
GLRGTIIGIKGANREADVLFEVLFDEEFPGGLTIRCSPGRGYRLPTSALVNLSHGSRSETGNQKLTAIVK   1121 - 1190
PQPAVHQHSSSSSVSSGHLGALNHSPQSLFVPTQVPTKDDDEFCNIWQSLQGSGKMQYFQPTIQEKGAVL   1191 - 1260
PQEISQVNQHHKSGFNDNSVKYQQRKHDPHRKFKEECKSPKAECWSQKMSNKQPNSGIENFLASLNISKE   1261 - 1330
NEVQSSHHGEPPSEEHLSPQSFAMGTRMLKEILKIDGSNTVDHKNEIKQIANEIPVSSNRRDEYGLPSQP   1331 - 1400
KQNKKLASYMNKPHSANEYHNVQSMDNMCWPAPSQIPPVSTPVTELSRICSLVGMPQPDFSFLRMPQTMT   1401 - 1470
VCQVKLSNGLLVHGPQCHSENEAKEKAALFALQQLGSLGMNFPLPSQVFANYPSAVPPGTIPPAFPPPTG   1471 - 1540
WDHYGSNYALGAANIMPSSSHLFGSMPWGPSVPVPGKPFHHTLYSGTMPMAGGIPGGVHNQFIPLQVTKK   1541 - 1610
RVANKKNFENKEAQSSQATPVQTSQPDSSNIVKVSPRESSSASLKSSPIAQPASSFQVETASQGHSISHH   1611 - 1680
KSTPISSSRRKSRKLAVNFGVSKPSE                                               1681 - 1706
//

Text Mined References (36)

PMID Year Title
25855736 2015 Regulation of Hepatitis C Virus Genome Replication by Xrn1 and MicroRNA-122 Binding to Individual Sites in the 5' Untranslated Region.
25797256 2015 A dual yet opposite growth-regulating function of miR-204 and its target XRN1 in prostate adenocarcinoma cells and neuroendocrine-like prostate cancer cells.
25766294 2015 Cellular 5'-3' mRNA exonuclease Xrn1 controls double-stranded RNA accumulation and anti-viral responses.
25673723 2015 Dissecting the roles of the 5' exoribonucleases Xrn1 and Xrn2 in restricting hepatitis C virus replication.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23756462 2013 Exonuclease hDIS3L2 specifies an exosome-independent 3'-5' degradation pathway of human cytoplasmic mRNA.
23517755 XRN 5'?3' exoribonucleases: structure, mechanisms and functions.
23471000 2013 Degradation of initiator tRNAMet by Xrn1/2 via its accumulation in the nucleus of heat-treated HeLa cells.
23248316 2013 Competing and noncompeting activities of miR-122 and the 5' exonuclease Xrn1 in regulation of hepatitis C virus replication.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...