Property Summary

NCBI Gene PubMed Count 31
PubMed Score 114.20
PubTator Score 38.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
juvenile dermatomyositis 1189 2.05169644319244E-10
osteosarcoma 7933 1.50230068181259E-9
acute quadriplegic myopathy 1157 1.78356272269399E-6
tuberculosis and treatment for 3 months 327 2.3618543192417E-5
group 4 medulloblastoma 1875 1.51985168644502E-4
spina bifida 1064 0.0448751530129997
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -2.728 0.000
group 4 medulloblastoma 1.200 0.000
juvenile dermatomyositis 1.708 0.000
acute quadriplegic myopathy 1.534 0.000
tuberculosis and treatment for 3 months -1.600 0.000
spina bifida -1.692 0.045

Synonym

Accession Q8IZH2 Q4G0S3 Q68D88 Q6AI24 Q6MZS8 Q86WS7 Q8N8U4 Q9UF39
Symbols SEP1

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
C. elegans OMA EggNOG
S.cerevisiae OMA EggNOG

Gene RIF (9)

PMID Text
25855736 Occupation of each miR-122 binding site on 5' untranslated region of the hepatitis C virus genome contributes equally and cooperatively to virus replication via protecting from Xrn1 exoribonuclease degradation.
25797256 Data show that the AR-miR-204-XRN1-miR-34a positive feedback loop and a dual function of miR-204/XRN1 axis in prostate cancer.
25766294 Thus, Xrn1 is a cellular factor regulating dsRNA accumulation and dsRNA-responsive innate immune effectors.
25673723 Authors conclude that Xrn1 is the dominant 5' exoribonuclease mediating decay of hepatitis C virus RNA and that miR-122 provides protection against it
25631074 Cellular biotinylated 5'-3' exoribonuclease 1 protein (XRN1) is incorporated into HIV-1 Gag virus-like particles
23248316 Data show that 5' exonuclease Xrn1 knockdown and miR-122 supplementation have equal, redundant, and nonadditive effects on the rate of viral RNA decay, indicating that miR-122 protects HCV RNA from 5' decay.
23142987 findings reveal a role for XRN1 in decapping and provide a molecular basis for the coupling of decapping to 5'-->3' mRNA degrada
12515382 LSm1-7 proteins colocalize with DCP1,DCP2 and Xrn1 in cytoplasmic foci
9049243 Mouse Xrn1 plays a role in RNA turnover.

AA Sequence

MGVPKFYRWISERYPCLSEVVKEHQIPEFDNLYLDMNGIIHQCSHPNDDDVHFRISDDKIFTDIFHYLEV      1 - 70
LFRIIKPRKVFFMAVDGVAPRAKMNQQRGRRFRSAKEAEDKIKKAIEKGETLPTEARFDSNCITPGTEFM     71 - 140
ARLHEHLKYFVNMKISTDKSWQGVTIYFSGHETPGEGEHKIMEFIRSEKAKPDHDPNTRHCLYGLDADLI    141 - 210
MLGLTSHEAHFSLLREEVRFGGKKTQRVCAPEETTFHLLHLSLMREYIDYEFSVLKEKITFKYDIERIID    211 - 280
DWILMGFLVGNDFIPHLPHLHINHDALPLLYGTYVTILPELGGYINESGHLNLPRFEKYLVKLSDFDREH    281 - 350
FSEVFVDLKWFESKVGNKYLNEAAGVAAEEARNYKEKKKLKGQENSLCWTALDKNEGEMITSKDNLEDET    351 - 420
EDDDLFETEFRQYKRTYYMTKMGVDVVSDDFLADQAACYVQAIQWILHYYYHGVQSWSWYYPYHYAPFLS    421 - 490
DIHNISTLKIHFELGKPFKPFEQLLAVLPAASKNLLPACYQHLMTNEDSPIIEYYPPDFKTDLNGKQQEW    491 - 560
EAVVLIPFIDEKRLLEAMETCNHSLKKEERKRNQHSECLMCWYDRDTEFIYPSPWPEKFPAIERCCTRYK    561 - 630
IISLDAWRVDINKNKITRIDQKALYFCGFPTLKHIRHKFFLKKSGVQVFQQSSRGENMMLEILVDAESDE    631 - 700
LTVENVASSVLGKSVFVNWPHLEEARVVAVSDGETKFYLEEPPGTQKLYSGRTAPPSKVVHLGDKEQSNW    701 - 770
AKEVQGISEHYLRRKGIIINETSAVVYAQLLTGRKYQINQNGEVRLEKQWSKQVVPFVYQTIVKDIRAFD    771 - 840
SRFSNIKTLDDLFPLRSMVFMLGTPYYGCTGEVQDSGDVITEGRIRVIFSIPCEPNLDALIQNQHKYSIK    841 - 910
YNPGYVLASRLGVSGYLVSRFTGSIFIGRGSRRNPHGDHKANVGLNLKFNKKNEEVPGYTKKVGSEWMYS    911 - 980
SAAEQLLAEYLERAPELFSYIAKNSQEDVFYEDDIWPGENENGAEKVQEIITWLKGHPVSTLSRSSCDLQ    981 - 1050
ILDAAIVEKIEEEVEKCKQRKNNKKVRVTVKPHLLYRPLEQQHGVIPDRDAEFCLFDRVVNVRENFSVPV   1051 - 1120
GLRGTIIGIKGANREADVLFEVLFDEEFPGGLTIRCSPGRGYRLPTSALVNLSHGSRSETGNQKLTAIVK   1121 - 1190
PQPAVHQHSSSSSVSSGHLGALNHSPQSLFVPTQVPTKDDDEFCNIWQSLQGSGKMQYFQPTIQEKGAVL   1191 - 1260
PQEISQVNQHHKSGFNDNSVKYQQRKHDPHRKFKEECKSPKAECWSQKMSNKQPNSGIENFLASLNISKE   1261 - 1330
NEVQSSHHGEPPSEEHLSPQSFAMGTRMLKEILKIDGSNTVDHKNEIKQIANEIPVSSNRRDEYGLPSQP   1331 - 1400
KQNKKLASYMNKPHSANEYHNVQSMDNMCWPAPSQIPPVSTPVTELSRICSLVGMPQPDFSFLRMPQTMT   1401 - 1470
VCQVKLSNGLLVHGPQCHSENEAKEKAALFALQQLGSLGMNFPLPSQVFANYPSAVPPGTIPPAFPPPTG   1471 - 1540
WDHYGSNYALGAANIMPSSSHLFGSMPWGPSVPVPGKPFHHTLYSGTMPMAGGIPGGVHNQFIPLQVTKK   1541 - 1610
RVANKKNFENKEAQSSQATPVQTSQPDSSNIVKVSPRESSSASLKSSPIAQPASSFQVETASQGHSISHH   1611 - 1680
KSTPISSSRRKSRKLAVNFGVSKPSE                                               1681 - 1706
//

Text Mined References (36)

PMID Year Title
25855736 2015 Regulation of Hepatitis C Virus Genome Replication by Xrn1 and MicroRNA-122 Binding to Individual Sites in the 5' Untranslated Region.
25797256 2015 A dual yet opposite growth-regulating function of miR-204 and its target XRN1 in prostate adenocarcinoma cells and neuroendocrine-like prostate cancer cells.
25766294 2015 Cellular 5'-3' mRNA exonuclease Xrn1 controls double-stranded RNA accumulation and anti-viral responses.
25673723 2015 Dissecting the roles of the 5' exoribonucleases Xrn1 and Xrn2 in restricting hepatitis C virus replication.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23756462 2013 Exonuclease hDIS3L2 specifies an exosome-independent 3'-5' degradation pathway of human cytoplasmic mRNA.
23517755 XRN 5'?3' exoribonucleases: structure, mechanisms and functions.
23471000 2013 Degradation of initiator tRNAMet by Xrn1/2 via its accumulation in the nucleus of heat-treated HeLa cells.
23248316 2013 Competing and noncompeting activities of miR-122 and the 5' exonuclease Xrn1 in regulation of hepatitis C virus replication.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...