Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.57
PubTator Score 1.64

Knowledge Summary

Patent (438)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 0.000

AA Sequence

MGLTAYGNRRVQPGELPFGANLTLIHTRAQPVICSKLLLTKRVSPISFFLSKFQNSWGEDGWVQLDQLPS      1 - 70
PNAVSSDQVHCSAGCTHRKCGWAASKSKEKVPARPHGVCDGVCTDYSQCTQPCPPDTQGNMGFSCRQKTW     71 - 140
HKITDTCQTLNALNIFEEDSRLVQPFEDNIKISVYTGKSETITDMLLQKCPTDLSCVIRNIQQSPWIPGN    141 - 210
IAVIVQLLHNISTAIWTGVDEAKMQSYSTIANHILNSKSISNWTFIPDRNSSYILLHSVNSFARRLFIDK    211 - 280
HPVDISDVFIHTMGTTISGDNIGKNFTFSMRINDTSNEVTGRVLISRDELRKVPSPSQVISIAFPTIGAI    281 - 350
LEASLLENVTVNGLVLSAILPKELKRISLIFEKISKSEERRTQCVGWHSVENRWDQQACKMIQENSQQAV    351 - 420
CKCRPSKLFTSFSILMSPHILESLILTYITYVGLGISICSLILCLSIEVLVWSQVTKTEITYLRHVCIVN    421 - 490
IAATLLMADVWFIVASFLSGPITHHKGCVAATFFVHFFYLSVFFWMLAKALLILYGIMIVFHTLPKSVLV    491 - 560
ASLFSVGYGCPLAIAAITVAATEPGKGYLRPEICWLNWDMTKALLAFVIPALAIVVVNLITVTLVIVKTQ    561 - 630
RAAIGNSMFQEVRAIVRISKNIAILTPLLGLTWGFGVATVIDDRSLAFHIIFSLLNAFQVSPDASDQVQS    631 - 700
ERIHEDVL                                                                  701 - 708
//

Text Mined References (8)

PMID Year Title
25713288 2015 International Union of Basic and Clinical Pharmacology. XCIV. Adhesion G protein-coupled receptors.
20149256 2010 Orphan receptor GPR110, an oncogene overexpressed in lung and prostate cancer.
15203201 2004 The human and mouse repertoire of the adhesion family of G-protein-coupled receptors.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12679517 2003 The G protein-coupled receptor repertoires of human and mouse.
12565841 2003 There exist at least 30 human G-protein-coupled receptors with long Ser/Thr-rich N-termini.
12435584 2002 Novel human G protein-coupled receptors with long N-terminals containing GPS domains and Ser/Thr-rich regions.
12044878 2002 Identification of G protein-coupled receptor genes from the human genome sequence.