Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.74
PubTator Score 0.56

Knowledge Summary

Patent (503)

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (2)

Disease log2 FC p
interstitial cystitis -1.600 0.001
spina bifida -1.329 0.030

AA Sequence

MKMKSQATMICCLVFFLSTECSHYRSKIHLKAGDKLQSPEGKPKTGRIQEKCEGPCISSSNCSQPCAKDF      1 - 70
HGEIGFTCNQKKWQKSAETCTSLSVEKLFKDSTGASRLSVAAPSIPLHILDFRAPETIESVAQGIRKNCP     71 - 140
FDYACITDMVKSSETTSGNIAFIVELLKNISTDLSDNVTREKMKSYSEVANHILDTAAISNWAFIPNKNA    141 - 210
SSDLLQSVNLFARQLHIHNNSENIVNELFIQTKGFHINHNTSEKSLNFSMSMNNTTEDILGMVQIPRQEL    211 - 280
RKLWPNASQAISIAFPTLGAILREAHLQNVSLPRQVNGLVLSVVLPERLQEIILTFEKINKTRNARAQCV    281 - 350
GWHSKKRRWDEKACQMMLDIRNEVKCRCNYTSVVMSFSILMSSKSMTDKVLDYITCIGLSVSILSLVLCL    351 - 420
IIEATVWSRVVVTEISYMRHVCIVNIAVSLLTANVWFIIGSHFNIKAQDYNMCVAVTFFSHFFYLSLFFW    421 - 490
MLFKALLIIYGILVIFRRMMKSRMMVIGFAIGYGCPLIIAVTTVAITEPEKGYMRPEACWLNWDNTKALL    491 - 560
AFAIPAFVIVAVNLIVVLVVAVNTQRPSIGSSKSQDVVIIMRISKNVAILTPLLGLTWGFGIATLIEGTS    561 - 630
LTFHIIFALLNAFQGFFILLFGTIMDHKIRDALRMRMSSLKGKSRAAENASLGPTNGSKLMNRQG         631 - 695
//

Text Mined References (10)

PMID Year Title
25713288 2015 International Union of Basic and Clinical Pharmacology. XCIV. Adhesion G protein-coupled receptors.
21822266 2011 Exome sequencing supports a de novo mutational paradigm for schizophrenia.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15203201 2004 The human and mouse repertoire of the adhesion family of G-protein-coupled receptors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12679517 2003 The G protein-coupled receptor repertoires of human and mouse.
12435584 2002 Novel human G protein-coupled receptors with long N-terminals containing GPS domains and Ser/Thr-rich regions.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.