Property Summary

NCBI Gene PubMed Count 24
Grant Count 7
Funding $584,005.33
PubMed Score 8.64
PubTator Score 3.09

Knowledge Summary

Patent (2,334)

Expression

Gene RIF (7)

PMID Text
24008316 These findings show that GPR116 is crucial for the metastasis of breast cancer and support GPR116 as a potential prognostic marker and drug target against metastatic human breast cancer.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18314133 SEA domain autoproteolysis accelerated by conformational strain: mechanistic aspects.
18308334 SEA domain autoproteolysis accelerated by conformational strain.

AA Sequence

MKSPRRTTLCLMFIVIYSSKAALNWNYESTIHPLSLHEHEPAGEEALRQKRAVATKSPTAEEYTVNIEIS      1 - 70
FENASFLDPIKAYLNSLSFPIHGNNTDQITDILSINVTTVCRPAGNEIWCSCETGYGWPRERCLHNLICQ     71 - 140
ERDVFLPGHHCSCLKELPPNGPFCLLQEDVTLNMRVRLNVGFQEDLMNTSSALYRSYKTDLETAFRKGYG    141 - 210
ILPGFKGVTVTGFKSGSVVVTYEVKTTPPSLELIHKANEQVVQSLNQTYKMDYNSFQAVTINESNFFVTP    211 - 280
EIIFEGDTVSLVCEKEVLSSNVSWRYEEQQLEIQNSSRFSIYTALFNNMTSVSKLTIHNITPGDAGEYVC    281 - 350
KLILDIFEYECKKKIDVMPIQILANEEMKVMCDNNPVSLNCCSQGNVNWSKVEWKQEGKINIPGTPETDI    351 - 420
DSSCSRYTLKADGTQCPSGSSGTTVIYTCEFISAYGARGSANIKVTFISVANLTITPDPISVSEGQNFSI    421 - 490
KCISDVSNYDEVYWNTSAGIKIYQRFYTTRRYLDGAESVLTVKTSTREWNGTYHCIFRYKNSYSIATKDV    491 - 560
IVHPLPLKLNIMVDPLEATVSCSGSHHIKCCIEEDGDYKVTFHTGSSSLPAAKEVNKKQVCYKHNFNASS    561 - 630
VSWCSKTVDVCCHFTNAANNSVWSPSMKLNLVPGENITCQDPVIGVGEPGKVIQKLCRFSNVPSSPESPI    631 - 700
GGTITYKCVGSQWEEKRNDCISAPINSLLQMAKALIKSPSQDEMLPTYLKDLSISIDKAEHEISSSPGSL    701 - 770
GAIINILDLLSTVPTQVNSEMMTHVLSTVNVILGKPVLNTWKVLQQQWTNQSSQLLHSVERFSQALQSGD    771 - 840
SPPLSFSQTNVQMSSMVIKSSHPETYQQRFVFPYFDLWGNVVIDKSYLENLQSDSSIVTMAFPTLQAILA    841 - 910
QDIQENNFAESLVMTTTVSHNTTMPFRISMTFKNNSPSGGETKCVFWNFRLANNTGGWDSSGCYVEEGDG    911 - 980
DNVTCICDHLTSFSILMSPDSPDPSSLLGILLDIISYVGVGFSILSLAACLVVEAVVWKSVTKNRTSYMR    981 - 1050
HTCIVNIAASLLVANTWFIVVAAIQDNRYILCKTACVAATFFIHFFYLSVFFWMLTLGLMLFYRLVFILH   1051 - 1120
ETSRSTQKAIAFCLGYGCPLAISVITLGATQPREVYTRKNVCWLNWEDTKALLAFAIPALIIVVVNITIT   1121 - 1190
IVVITKILRPSIGDKPCKQEKSSLFQISKSIGVLTPLLGLTWGFGLTTVFPGTNLVFHIIFAILNVFQGL   1191 - 1260
FILLFGCLWDLKVQEALLNKFSLSRWSSQHSKSTSLGSSTPVFSMSSPISRRFNNLFGKTGTYNVSTPEA   1261 - 1330
TSSSLENSSSASSLLN                                                         1331 - 1346
//

Text Mined References (26)

PMID Year Title
25713288 2015 International Union of Basic and Clinical Pharmacology. XCIV. Adhesion G protein-coupled receptors.
24008316 2013 GPR116, an adhesion G-protein-coupled receptor, promotes breast cancer metastasis via the G?q-p63RhoGEF-Rho GTPase pathway.
23684610 2013 Essential regulation of lung surfactant homeostasis by the orphan G protein-coupled receptor GPR116.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
18314133 2008 SEA domain autoproteolysis accelerated by conformational strain: mechanistic aspects.
18308334 2008 SEA domain autoproteolysis accelerated by conformational strain: energetic aspects.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...