Property Summary

NCBI Gene PubMed Count 24
PubMed Score 10.80
PubTator Score 3.09

Knowledge Summary

Patent (2,334)

Expression

  Differential Expression (24)

Disease log2 FC p
acute myeloid leukemia -1.300 4.9e-02
adrenocortical carcinoma -1.503 7.1e-05
astrocytic glioma -1.400 5.8e-03
atypical teratoid / rhabdoid tumor -1.100 2.1e-02
Breast cancer 1.100 1.0e-04
breast carcinoma -1.300 6.6e-04
ductal carcinoma in situ -1.500 6.7e-04
group 4 medulloblastoma -1.200 2.3e-02
interstitial cystitis 1.100 6.1e-05
intraductal papillary-mucinous adenoma (... -2.200 2.9e-03
intraductal papillary-mucinous carcinoma... -2.500 8.7e-04
intraductal papillary-mucinous neoplasm ... -2.000 2.3e-02
invasive ductal carcinoma -2.000 4.5e-04
juvenile dermatomyositis 1.063 7.5e-06
lung adenocarcinoma -1.500 1.1e-09
lung cancer -3.600 5.0e-05
lung carcinoma -2.600 2.3e-25
medulloblastoma, large-cell -2.200 7.7e-05
non-small cell lung cancer -2.597 3.4e-17
osteosarcoma 2.452 2.2e-03
ovarian cancer 1.800 7.6e-04
pterygium 1.100 3.6e-03
ulcerative colitis 2.200 6.1e-05
urothelial carcinoma 2.500 4.4e-06

 CSPA Cell Line (3)

Gene RIF (7)

AA Sequence

MKSPRRTTLCLMFIVIYSSKAALNWNYESTIHPLSLHEHEPAGEEALRQKRAVATKSPTAEEYTVNIEIS      1 - 70
FENASFLDPIKAYLNSLSFPIHGNNTDQITDILSINVTTVCRPAGNEIWCSCETGYGWPRERCLHNLICQ     71 - 140
ERDVFLPGHHCSCLKELPPNGPFCLLQEDVTLNMRVRLNVGFQEDLMNTSSALYRSYKTDLETAFRKGYG    141 - 210
ILPGFKGVTVTGFKSGSVVVTYEVKTTPPSLELIHKANEQVVQSLNQTYKMDYNSFQAVTINESNFFVTP    211 - 280
EIIFEGDTVSLVCEKEVLSSNVSWRYEEQQLEIQNSSRFSIYTALFNNMTSVSKLTIHNITPGDAGEYVC    281 - 350
KLILDIFEYECKKKIDVMPIQILANEEMKVMCDNNPVSLNCCSQGNVNWSKVEWKQEGKINIPGTPETDI    351 - 420
DSSCSRYTLKADGTQCPSGSSGTTVIYTCEFISAYGARGSANIKVTFISVANLTITPDPISVSEGQNFSI    421 - 490
KCISDVSNYDEVYWNTSAGIKIYQRFYTTRRYLDGAESVLTVKTSTREWNGTYHCIFRYKNSYSIATKDV    491 - 560
IVHPLPLKLNIMVDPLEATVSCSGSHHIKCCIEEDGDYKVTFHTGSSSLPAAKEVNKKQVCYKHNFNASS    561 - 630
VSWCSKTVDVCCHFTNAANNSVWSPSMKLNLVPGENITCQDPVIGVGEPGKVIQKLCRFSNVPSSPESPI    631 - 700
GGTITYKCVGSQWEEKRNDCISAPINSLLQMAKALIKSPSQDEMLPTYLKDLSISIDKAEHEISSSPGSL    701 - 770
GAIINILDLLSTVPTQVNSEMMTHVLSTVNVILGKPVLNTWKVLQQQWTNQSSQLLHSVERFSQALQSGD    771 - 840
SPPLSFSQTNVQMSSMVIKSSHPETYQQRFVFPYFDLWGNVVIDKSYLENLQSDSSIVTMAFPTLQAILA    841 - 910
QDIQENNFAESLVMTTTVSHNTTMPFRISMTFKNNSPSGGETKCVFWNFRLANNTGGWDSSGCYVEEGDG    911 - 980
DNVTCICDHLTSFSILMSPDSPDPSSLLGILLDIISYVGVGFSILSLAACLVVEAVVWKSVTKNRTSYMR    981 - 1050
HTCIVNIAASLLVANTWFIVVAAIQDNRYILCKTACVAATFFIHFFYLSVFFWMLTLGLMLFYRLVFILH   1051 - 1120
ETSRSTQKAIAFCLGYGCPLAISVITLGATQPREVYTRKNVCWLNWEDTKALLAFAIPALIIVVVNITIT   1121 - 1190
IVVITKILRPSIGDKPCKQEKSSLFQISKSIGVLTPLLGLTWGFGLTTVFPGTNLVFHIIFAILNVFQGL   1191 - 1260
FILLFGCLWDLKVQEALLNKFSLSRWSSQHSKSTSLGSSTPVFSMSSPISRRFNNLFGKTGTYNVSTPEA   1261 - 1330
TSSSLENSSSASSLLN                                                         1331 - 1346
//

Text Mined References (26)

PMID Year Title