Property Summary

NCBI Gene PubMed Count 26
PubMed Score 38.68
PubTator Score 31.80

Knowledge Summary


No data available


  Disease Sources (4)

Disease Target Count
Leukemia 88
Myeloid Leukemia 19
Disease Target Count P-value
juvenile dermatomyositis 1189 1.29580602948842E-12
psoriasis 6685 2.35946656662012E-11
ovarian cancer 8492 4.30645119214745E-6
acute quadriplegic myopathy 1157 8.57134142038314E-5
Rheumatoid Arthritis 1171 5.49598833572994E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00101565642748227
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00170739082788016
osteosarcoma 7933 0.00327680186863933
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00457255883657203
group 4 medulloblastoma 1875 0.00489916559192535
pancreatic cancer 2300 0.00492745205510467
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00578446476848664
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00768914157564231
aldosterone-producing adenoma 664 0.0289932455176396
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Human immunodeficiency virus infectious disease 129 3.032 1.5




4L58   2LV9  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Opossum OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG

Gene RIF (22)

27002166 MLL5 preserves spindle bipolarity through maintaining cytosolic PLK1 in a nonaggregated form.
26678539 MLL5 interacts with OGT and USP7 to form a stable ternary complex. Upregulation of MLL5 expression was correlated with increased expression of OGT and USP7 in human primary cervical adenocarcinomas.
26626085 Suggest a role for MLL5 and H3.3 in maintaining self-renewal hierarchies in adult glioblastomas.
25670814 O-GlcNAcylation of MLL5beta at T440 residue is critical for MLL5 recruitment to the HPV16/18-long control region through its interaction with AP-1.
24895338 Improved outcome is observed in decitabine-treated patients who express MLL5 at high levels.
24796963 KMT2E expression retained association with poor acute promyelocytic leukaemia remission rate and shorter survival while the association with disease-free survival was of marginal significance.
24130829 NMR solution structure of the MLL5 PHD domain
23958951 MLL5 is a cellular ligand for the natural cytotoxicity receptor NKp44.
23798402 findings provide first insights into the molecular basis for the recruitment, exclusion, and regulation of MLL5 at chromatin
23754336 these results indicate that the suppression of MLL genes, especially MLL2 and MLL5, take part in modulating breast carcinogenesis.

AA Sequence

PHGVQGPQQASPVPGQIPIHRAQVPPTFQNNYHGSGWH                                   1821 - 1858

Text Mined References (31)

PMID Year Title
27002166 2016 MLL5 maintains spindle bipolarity by preventing aberrant cytosolic aggregation of PLK1.
26678539 2015 Mixed Lineage Leukemia 5 (MLL5) Protein Stability Is Cooperatively Regulated by O-GlcNac Transferase (OGT) and Ubiquitin Specific Protease 7 (USP7).
26626085 2015 MLL5 Orchestrates a Cancer Self-Renewal State by Repressing the Histone Variant H3.3 and Globally Reorganizing Chromatin.
25670814 2015 O-GlcNAcylation of MLL5? is essential for MLL5?-AP-1 transcription complex assembly at the HPV16/18-long control region.
24895338 2014 Impact of MLL5 expression on decitabine efficacy and DNA methylation in acute myeloid leukemia.
24796963 2014 Prognostic impact of KMT2E transcript levels on outcome of patients with acute promyelocytic leukaemia treated with all-trans retinoic acid and anthracycline-based chemotherapy: an International Consortium on Acute Promyelocytic Leukaemia study.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24130829 2013 Solution NMR structure and histone binding of the PHD domain of human MLL5.
23958951 2013 Identification of a cellular ligand for the natural cytotoxicity receptor NKp44.
23798402 2013 Molecular basis for chromatin binding and regulation of MLL5.