Property Summary

NCBI Gene PubMed Count 12
PubMed Score 30.53
PubTator Score 26.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Hiatus hernia 7 3.33 1.7
Pick's disease 14 3.23 1.6

Synonym

Accession Q8IZA3 Q86WT7
Symbols H1.8
H1oo
osH1

Gene

Gene RIF (2)

PMID Text
19147139 After intracytoplasmic sperm injection, the assembly of H1FOO on sperm chromatin during decondensation seems to occur very quickly, and hH1FOO protein is localized in all oocytes from primordial to Graafian follicles.
12711322 Structure and gene expression of osH1.

AA Sequence

MAPGSVTSDISPSSTSTAGSSRSPESEKPGPSHGGVPPGGPSHSSLPVGRRHPPVLRMVLEALQAGEQRR      1 - 70
GTSVAAIKLYILHKYPTVDVLRFKYLLKQALATGMRRGLLARPLNSKARGATGSFKLVPKHKKKIQPRKM     71 - 140
APATAPRRAGEAKGKGPKKPSEAKEDPPNVGKVKKAAKRPAKVQKPPPKPGAATEKARKQGGAAKDTRAQ    141 - 210
SGEARKVPPKPDKAMRAPSSAGGLSRKAKAKGSRSSQGDAEAYRKTKAESKSSKPTASKVKNGAASPTKK    211 - 280
KVVAKAKAPKAGQGPNTKAAAPAKGSGSKVVPAHLSRKTEAPKGPRKAGLPIKASSSKVSSQRAEA        281 - 346
//

Text Mined References (13)

PMID Year Title
26689747 2016 Role of H1 linker histones in mammalian development and stem cell differentiation.
24781148 2014 Histone variants: key players of chromatin.
24614311 2014 Every amino acid matters: essential contributions of histone variants to mammalian development and disease.
22650316 2012 A unified phylogeny-based nomenclature for histone variants.
19147139 2010 Expression of human oocyte-specific linker histone protein and its incorporation into sperm chromatin during fertilization.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15371275 2005 H1FOO is coupled to the initiation of oocytic growth.
14729479 2004 Rapid replacement of somatic linker histones with the oocyte-specific linker histone H1foo in nuclear transfer.
14729478 2004 Rapid H1 linker histone transitions following fertilization or somatic cell nuclear transfer: evidence for a uniform developmental program in mice.
More...