Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.98
PubTator Score 6.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma 1.300 5.5e-03
breast carcinoma 1.400 6.8e-03
cystic fibrosis 1.446 7.8e-05
ductal carcinoma in situ 2.100 3.3e-02
ependymoma 1.600 1.1e-03
fibroadenoma 1.400 8.3e-03
glioblastoma 1.200 1.7e-02
group 3 medulloblastoma 2.500 3.2e-04
interstitial cystitis -1.600 1.3e-02
intraductal papillary-mucinous adenoma (... 1.200 2.4e-03
intraductal papillary-mucinous carcinoma... 1.500 1.8e-03
intraductal papillary-mucinous neoplasm ... 2.100 5.8e-03
invasive ductal carcinoma 3.100 7.7e-03
lung carcinoma 1.400 5.6e-10
non primary Sjogren syndrome sicca -1.100 2.7e-02
non-small cell lung cancer -1.102 1.3e-05
osteosarcoma 1.036 3.3e-02
pituitary cancer 1.300 2.0e-02
sarcoidosis -1.600 2.1e-02
spina bifida -1.434 4.5e-02
subependymal giant cell astrocytoma 1.193 1.6e-02

Gene RIF (3)

AA Sequence

MEADGDGEELARLRSVFAACDANRSGRLEREEFRALCTELRVRPADAEAVFQRLDADRDGAITFQEFARG      1 - 70
FLGSLRGGRRRDWGPLDPAPAVSEAGPETHDSEEDEGDEDAAAALATSCGPASPGRAWQDFQARLGDEAK     71 - 140
FIPREEQVSTLYQNINLVEPRLIQPYEHVIKNFIREIRLQSTEMENLAIAVKRAQDKAAMQLSELEEEMD    141 - 210
QRIQAAEHKTRKDEKRKAEEALSDLRRQYETEVGDLQVTIKKLRKLEEQSKRVSQKEDVAALKKQIYDLS    211 - 280
MENQKVKKDLLEAQTNIAFLQSELDALKSDYADQSLNTERDLEIIRAYTEDRNSLERQIEILQTANRKLH    281 - 350
DSNDGLRSALENSYSKFNRSLHINNISPGNTISRSSPKFIGHSPQPLGYDRSSRSSYVDEDCDSLALCDP    351 - 420
LQRTNCEVDSLPESCFDSGLSTLRDPNEYDSEVEYKHQRGFQRSHGVQESFGGDASDTDVPDIRDEETFG    421 - 490
LEDVASVLDWKPQGSVSEGSIVSSSRKPISALSPQTDLVDDNAKSFSSQKAYKIVLAGDAAVGKSSFLMR    491 - 560
LCKNEFRENISATLGVDFQMKTLIVDGERTVLQLWDTAGQERFRSIAKSYFRKADGVLLLYDVTCEKSFL    561 - 630
NIREWVDMIEDAAHETVPIMLVGNKADIRDTAATEGQKCVPGHFGEKLAMTYGALFCETSAKDGSNIVEA    631 - 700
VLHLAREVKKRTDKDDSRSITNLTGTNSKKSPQMKNCCNG                                  701 - 740
//

Text Mined References (13)

PMID Year Title