Property Summary

NCBI Gene PubMed Count 6
PubMed Score 23.09
PubTator Score 1.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Chloracne 32 0.0 0.0
Disease Target Count Z-score Confidence
Osteoporosis 363 3.216 1.6

Expression

 GO Component (1)

Gene RIF (2)

AA Sequence

MKEESAAQLGCCHRPMALGGTGGSLSPSLDFQLFRGDQVFSACRPLPDMVDAHGPSCASWLCPLPLAPGR      1 - 70
SALLACLQDLDLNLCTPQPAPLGTDLQGLQEDALSMKHEPPGLQASSTDDKKFTVKYPQNKDKLGKQPER     71 - 140
AGEGAPCPAFSSHNSSSPPPLQNRKSPSPLAFCPCPPVNSISKELPFLLHAFYPGYPLLLPPPHLFTYGA    141 - 210
LPSDQCPHLLMLPQDPSYPTMAMPSLLMMVNELGHPSARWETLLPYPGAFQASGQALPSQARNPGAGAAP    211 - 280
TDSPGLERGGMASPAKRVPLSSQTGTAALPYPLKKKNGKILYECNICGKSFGQLSNLKVHLRVHSGERPF    281 - 350
QCALCQKSFTQLAHLQKHHLVHTGERPHKCSIPWVPGRNHWKSFQAWREREVCHKRFSSSSNLKTHLRLH    351 - 420
SGARPFQCSVCRSRFTQHIHLKLHHRLHAPQPCGLVHTQLPLASLACLAQWHQGALDLMAVASEKHMGYD    421 - 490
IDEVKVSSTSQGKARAVSLSSAGTPLVMGQDQNN                                        491 - 524
//

Text Mined References (7)

PMID Year Title