Property Summary

NCBI Gene PubMed Count 6
PubMed Score 19.79
PubTator Score 1.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Osteoporosis 257 3.301 1.7
Chloracne 32

Expression

 GO Component (1)

Gene RIF (2)

PMID Text
26440905 Hobit's function in human T cells is highly adapted to lifelong, periodic challenges with varying, physiological doses of pathogens.
26179882 These data implicate Hobit as a novel transcriptional regulator in quiescent human effector-type CD8(+) T cells that regulates their immediate effector functions.

AA Sequence

MKEESAAQLGCCHRPMALGGTGGSLSPSLDFQLFRGDQVFSACRPLPDMVDAHGPSCASWLCPLPLAPGR      1 - 70
SALLACLQDLDLNLCTPQPAPLGTDLQGLQEDALSMKHEPPGLQASSTDDKKFTVKYPQNKDKLGKQPER     71 - 140
AGEGAPCPAFSSHNSSSPPPLQNRKSPSPLAFCPCPPVNSISKELPFLLHAFYPGYPLLLPPPHLFTYGA    141 - 210
LPSDQCPHLLMLPQDPSYPTMAMPSLLMMVNELGHPSARWETLLPYPGAFQASGQALPSQARNPGAGAAP    211 - 280
TDSPGLERGGMASPAKRVPLSSQTGTAALPYPLKKKNGKILYECNICGKSFGQLSNLKVHLRVHSGERPF    281 - 350
QCALCQKSFTQLAHLQKHHLVHTGERPHKCSIPWVPGRNHWKSFQAWREREVCHKRFSSSSNLKTHLRLH    351 - 420
SGARPFQCSVCRSRFTQHIHLKLHHRLHAPQPCGLVHTQLPLASLACLAQWHQGALDLMAVASEKHMGYD    421 - 490
IDEVKVSSTSQGKARAVSLSSAGTPLVMGQDQNN                                        491 - 524
//

Text Mined References (7)

PMID Year Title
26440905 2015 Hobit and human effector T-cell differentiation: The beginning of a long journey.
26179882 2015 Blimp-1 homolog Hobit identifies effector-type lymphocytes in humans.
22885984 2012 Mouse Hobit is a homolog of the transcriptional repressor Blimp-1 that regulates NKT cell effector differentiation.
20921622 2010 Molecular profiling of cytomegalovirus-induced human CD8+ T cell differentiation.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.