Property Summary

NCBI Gene PubMed Count 6
PubMed Score 19.79
PubTator Score 1.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Chloracne 32
Disease Target Count Z-score Confidence
Osteoporosis 259 3.301 1.7

Expression

Synonym

Accession Q8IZ20 Q5T141 Q5T146 Q5T147 Q5T149 Q8NEN4
Symbols Hobit

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid

 GO Component (1)

Gene RIF (2)

PMID Text
26440905 Hobit's function in human T cells is highly adapted to lifelong, periodic challenges with varying, physiological doses of pathogens.
26179882 These data implicate Hobit as a novel transcriptional regulator in quiescent human effector-type CD8(+) T cells that regulates their immediate effector functions.

AA Sequence

MKEESAAQLGCCHRPMALGGTGGSLSPSLDFQLFRGDQVFSACRPLPDMVDAHGPSCASWLCPLPLAPGR      1 - 70
SALLACLQDLDLNLCTPQPAPLGTDLQGLQEDALSMKHEPPGLQASSTDDKKFTVKYPQNKDKLGKQPER     71 - 140
AGEGAPCPAFSSHNSSSPPPLQNRKSPSPLAFCPCPPVNSISKELPFLLHAFYPGYPLLLPPPHLFTYGA    141 - 210
LPSDQCPHLLMLPQDPSYPTMAMPSLLMMVNELGHPSARWETLLPYPGAFQASGQALPSQARNPGAGAAP    211 - 280
TDSPGLERGGMASPAKRVPLSSQTGTAALPYPLKKKNGKILYECNICGKSFGQLSNLKVHLRVHSGERPF    281 - 350
QCALCQKSFTQLAHLQKHHLVHTGERPHKCSIPWVPGRNHWKSFQAWREREVCHKRFSSSSNLKTHLRLH    351 - 420
SGARPFQCSVCRSRFTQHIHLKLHHRLHAPQPCGLVHTQLPLASLACLAQWHQGALDLMAVASEKHMGYD    421 - 490
IDEVKVSSTSQGKARAVSLSSAGTPLVMGQDQNN                                        491 - 524
//

Text Mined References (7)

PMID Year Title
26440905 2015 Hobit and human effector T-cell differentiation: The beginning of a long journey.
26179882 2015 Blimp-1 homolog Hobit identifies effector-type lymphocytes in humans.
22885984 2012 Mouse Hobit is a homolog of the transcriptional repressor Blimp-1 that regulates NKT cell effector differentiation.
20921622 2010 Molecular profiling of cytomegalovirus-induced human CD8+ T cell differentiation.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.