Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active ulcerative colitis -1.171 1.1e-02
Breast cancer -2.100 7.2e-10
colon cancer -1.800 2.6e-04
Endometriosis -1.112 2.1e-02
facioscapulohumeral dystrophy 2.200 1.8e-05
gastric carcinoma -1.400 3.7e-02
group 3 medulloblastoma -2.700 2.6e-04
interstitial cystitis -1.900 3.4e-03
lung adenocarcinoma 1.900 7.9e-03
lung cancer -1.800 4.9e-04
lung carcinoma 1.100 5.1e-08
malignant mesothelioma -1.900 2.5e-06
medulloblastoma, large-cell -3.600 1.5e-06
nasopharyngeal carcinoma -1.400 6.8e-03
ovarian cancer -2.300 4.6e-05
primitive neuroectodermal tumor -1.300 1.5e-02
spina bifida -2.578 4.9e-02

AA Sequence

MEGAPTVRQVMNEGDSSLATDLQEDVEENPSPTVEENNVVVKKQGPNLHNWSGDWSFWISSSTYKDRNEE      1 - 70
YRRQFTHLPDTERLIADYACALQRDILLQGRLYLSENWLCFYSNIFRWETTISIALKNITFMTKEKTARL     71 - 140
IPNAIQIVTESEKFFFTSFGARDRSYLSIFRLWQNVLLDKSLTRQEFWQLLQQNYGTELGLNAEEMENLS    141 - 210
LSIEDVQPRSPGRSSLDDSGERDEKLSKSISFTSESISRVSETESFDGNSSKGGLGKEESQNEKQTKKSL    211 - 280
LPTLEKKLTRVPSKSLDLNKNEYLSLDKSSTSDSVDEENVPEKDLHGRLFINRIFHISADRMFELLFTSS    281 - 350
RFMQKFASSRNIIDVVSTPWTAELGGDQLRTMTYTIVLNSPLTGKCTAATEKQTLYKESREARFYLVDSE    351 - 420
VLTHDVPYHDYFYTVNRYCIIRSSKQKCRLRVSTDLKYRKQPWGLVKSLIEKNSWSSLEDYFKQLESDLL    421 - 490
IEESVLNQAIEDPGKLTGLRRRRRTFNRTAETVPKLSSQHSSGDVGLGAKGDITGKKKEMENYNVTLIVV    491 - 560
MSIFVLLLVLLNVTLFLKLSKIEHAAQSFYRLRLQEEKSLNLASDMVSRAETIQKNKDQAHRLKGVLRDS    561 - 630
IVMLEQLKSSLIMLQKTFDLLNKNKTGMAVES                                          631 - 662
//

Text Mined References (8)

PMID Year Title