Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Breast cancer 3099 7.2272856452086E-10
lung carcinoma 2844 5.09566481815631E-8
medulloblastoma, large-cell 6234 1.47347001417345E-6
malignant mesothelioma 3163 2.49596634671101E-6
ulcerative colitis 2087 5.32789908746204E-6
facioscapulohumeral dystrophy 286 1.76458639627666E-5
ovarian cancer 8492 4.61433744321428E-5
interstitial cystitis 2299 8.69877182553761E-5
colon cancer 1475 2.55007399833073E-4
group 3 medulloblastoma 2254 2.55205095272721E-4
lung cancer 4473 4.93727617406466E-4
nasopharyngeal carcinoma 1056 0.00684695082878629
lung adenocarcinoma 2714 0.00794544369244544
primitive neuroectodermal tumor 3031 0.0151249673963651
Endometriosis 535 0.0205375211879995
gastric carcinoma 832 0.0374902455329095
spina bifida 1064 0.0492452579782717

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -1.900 0.000
group 3 medulloblastoma -2.700 0.000
medulloblastoma, large-cell -3.600 0.000
primitive neuroectodermal tumor -1.300 0.015
colon cancer -1.800 0.000
lung cancer -1.800 0.000
ulcerative colitis -1.600 0.000
interstitial cystitis -2.100 0.000
lung adenocarcinoma 1.900 0.008
nasopharyngeal carcinoma -1.400 0.007
Endometriosis -1.112 0.021
Breast cancer -2.100 0.000
lung carcinoma 1.100 0.000
spina bifida -2.578 0.049
gastric carcinoma -1.400 0.037
ovarian cancer -2.300 0.000
facioscapulohumeral dystrophy 2.200 0.000

Synonym

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid

AA Sequence

MEGAPTVRQVMNEGDSSLATDLQEDVEENPSPTVEENNVVVKKQGPNLHNWSGDWSFWISSSTYKDRNEE      1 - 70
YRRQFTHLPDTERLIADYACALQRDILLQGRLYLSENWLCFYSNIFRWETTISIALKNITFMTKEKTARL     71 - 140
IPNAIQIVTESEKFFFTSFGARDRSYLSIFRLWQNVLLDKSLTRQEFWQLLQQNYGTELGLNAEEMENLS    141 - 210
LSIEDVQPRSPGRSSLDDSGERDEKLSKSISFTSESISRVSETESFDGNSSKGGLGKEESQNEKQTKKSL    211 - 280
LPTLEKKLTRVPSKSLDLNKNEYLSLDKSSTSDSVDEENVPEKDLHGRLFINRIFHISADRMFELLFTSS    281 - 350
RFMQKFASSRNIIDVVSTPWTAELGGDQLRTMTYTIVLNSPLTGKCTAATEKQTLYKESREARFYLVDSE    351 - 420
VLTHDVPYHDYFYTVNRYCIIRSSKQKCRLRVSTDLKYRKQPWGLVKSLIEKNSWSSLEDYFKQLESDLL    421 - 490
IEESVLNQAIEDPGKLTGLRRRRRTFNRTAETVPKLSSQHSSGDVGLGAKGDITGKKKEMENYNVTLIVV    491 - 560
MSIFVLLLVLLNVTLFLKLSKIEHAAQSFYRLRLQEEKSLNLASDMVSRAETIQKNKDQAHRLKGVLRDS    561 - 630
IVMLEQLKSSLIMLQKTFDLLNKNKTGMAVES                                          631 - 662
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.