Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -1.900 0.000
group 3 medulloblastoma -2.700 0.000
medulloblastoma, large-cell -3.600 0.000
primitive neuroectodermal tumor -1.300 0.015
colon cancer -1.800 0.000
lung cancer -1.800 0.000
ulcerative colitis -1.600 0.000
interstitial cystitis -2.100 0.000
lung adenocarcinoma 1.900 0.008
nasopharyngeal carcinoma -1.400 0.007
Endometriosis -1.112 0.021
Breast cancer -2.100 0.000
lung carcinoma 1.100 0.000
spina bifida -2.578 0.049
gastric carcinoma -1.400 0.037
ovarian cancer -2.300 0.000
facioscapulohumeral dystrophy 2.200 0.000

AA Sequence

MEGAPTVRQVMNEGDSSLATDLQEDVEENPSPTVEENNVVVKKQGPNLHNWSGDWSFWISSSTYKDRNEE      1 - 70
YRRQFTHLPDTERLIADYACALQRDILLQGRLYLSENWLCFYSNIFRWETTISIALKNITFMTKEKTARL     71 - 140
IPNAIQIVTESEKFFFTSFGARDRSYLSIFRLWQNVLLDKSLTRQEFWQLLQQNYGTELGLNAEEMENLS    141 - 210
LSIEDVQPRSPGRSSLDDSGERDEKLSKSISFTSESISRVSETESFDGNSSKGGLGKEESQNEKQTKKSL    211 - 280
LPTLEKKLTRVPSKSLDLNKNEYLSLDKSSTSDSVDEENVPEKDLHGRLFINRIFHISADRMFELLFTSS    281 - 350
RFMQKFASSRNIIDVVSTPWTAELGGDQLRTMTYTIVLNSPLTGKCTAATEKQTLYKESREARFYLVDSE    351 - 420
VLTHDVPYHDYFYTVNRYCIIRSSKQKCRLRVSTDLKYRKQPWGLVKSLIEKNSWSSLEDYFKQLESDLL    421 - 490
IEESVLNQAIEDPGKLTGLRRRRRTFNRTAETVPKLSSQHSSGDVGLGAKGDITGKKKEMENYNVTLIVV    491 - 560
MSIFVLLLVLLNVTLFLKLSKIEHAAQSFYRLRLQEEKSLNLASDMVSRAETIQKNKDQAHRLKGVLRDS    561 - 630
IVMLEQLKSSLIMLQKTFDLLNKNKTGMAVES                                          631 - 662
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.