Property Summary

NCBI Gene PubMed Count 6
PubMed Score 73.67

Knowledge Summary

Patent

No data available

AA Sequence

MKFILLWALLNLTVALAFNPDYTVSSTPPYLVYLKSDYLPCAGVLIHPLWVITAAHCNLPKLRVILGVTI      1 - 70
PADSNEKHLQVIGYEKMIHHPHFSVTSIDHDIMLIKLKTEAELNDYVKLANLPYQTISENTMCSVSTWSY     71 - 140
NVCDIYKEPDSLQTVNISVISKPQCRDAYKTYNITENMLCVGIVPGRRQPCKEVSAAPAICNGMLQGILS    141 - 210
FADGCVLRADVGIYAKIFYYIPWIENVIQNN                                           211 - 241
//