Property Summary

NCBI Gene PubMed Count 6
PubMed Score 8.49
PubTator Score 4.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma 1.200 6.6e-04
Astrocytoma, Pilocytic 1.300 1.3e-06
atypical teratoid / rhabdoid tumor 1.900 1.1e-03
cutaneous lupus erythematosus 1.800 1.1e-03
cystic fibrosis 1.100 4.8e-03
ependymoma 1.700 1.8e-07
glioblastoma 1.300 8.0e-05
lung cancer -1.300 4.8e-03
lung carcinoma -1.200 5.0e-15
ovarian cancer 1.200 2.0e-04

Gene RIF (2)

AA Sequence

MNISVDLETNYAELVLDVGRVTLGENSRKKMKDCKLRKKQNESVSRAMCALLNSGGGVIKAEIENEDYSY      1 - 70
TKDGIGLDLENSFSNILLFVPEYLDFMQNGNYFLIFVKSWSLNTSGLRITTLSSNLYKRDITSAKVMNAT     71 - 140
AALEFLKDMKKTRGRLYLRPELLAKRPCVDIQEENNMKALAGVFFDRTELDRKEKLTFTESTHVEIKNFS    141 - 210
TEKLLQRIKEILPQYVSAFANTDGGYLFIGLNEDKEIIGFKAEMSDLDDLEREIEKSIRKMPVHHFCMEK    211 - 280
KKINYSCKFLGVYDKGSLCGYVCALRVERFCCAVFAKEPDSWHVKDNRVMQLTRKEWIQFMVEAEPKFSS    281 - 350
SYEEVISQINTSLPAPHSWPLLEWQRQRHHCPGLSGRITYTPENLCRKLFLQHEGLKQLICEEMDSVRKG    351 - 420
SLIFSRSWSVDLGLQENHKVLCDALLISQDSPPVLYTFHMVQDEEFKGYSTQTALTLKQKLAKIGGYTKK    421 - 490
VCVMTKIFYLSPEGMTSCQYDLRSQVIYPESYYFTRRKYLLKALFKALKRLKSLRDQFSFAENLYQIIGI    491 - 560
DCFQKNDKKMFKSCRRLT                                                        561 - 578
//

Text Mined References (6)

PMID Year Title